Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591983 960 bp mRNA linear INV 14-MAY-2021 protein alr3466-like (LOC121403793), mRNA. ACCESSION XM_041591983 VERSION XM_041591983.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..960 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..960 /gene="LOC121403793" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:121403793" CDS 1..960 /gene="LOC121403793" /codon_start=1 /product="uncharacterized WD repeat-containing protein alr3466-like" /protein_id="XP_041447917.1" /db_xref="GeneID:121403793" /translation="MGAATQRSPWASQAGQPEERPTFSSPAAGSGRSRKRDFAGHTNA KGLMKVAHALKSGPEQAFLVHVFSVDASKPLEDMTLNTESSDKLVKRSLLGHQGRGLS TAAPFRPTAATFSAARTPIVSRLARHWLKAGTACVWDSEEIRAPLYRPRRRGRCLFHP NGHYLATGSSGGIVRIWGIVKGHQVRLLSGHMARICSLAFSKCGRFLASGGADNLVIV WDLPRERMIRCLSHHTAAVNSCVFDMNNNLLVVGSRDGRLSVWDFDRLVQESGAHENS SSVPPAEELPLKSYANHEGPICKVAFNSGNIMFGVRLESFKKS" misc_feature 4..>906 /gene="LOC121403793" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 466..570 /gene="LOC121403793" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 586..696 /gene="LOC121403793" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 709..789 /gene="LOC121403793" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgggagctg ccacgcaacg ctccccctgg gcatcccagg ctggacagcc cgaagaacgc 61 cccacgttct cgtcgcccgc tgctggttct ggtcgcagtc gcaagagaga tttcgctggt 121 cacacgaacg ccaaggggct catgaaagtt gcgcacgcct tgaagagtgg cccggagcaa 181 gccttcctgg tgcacgtctt ctcggtggat gcctcaaagc cgctggagga tatgacgctc 241 aacaccgaga gttcggacaa gctagtcaag cgcagcttgc tcggccacca ggggaggggg 301 ctgtctacag ctgcgccttt tcgcccgacg gccgctacct tctcagctgc tcggactccg 361 attgtttccc gcctggcccg gcattggctc aaggctggaa cggcttgtgt atgggactct 421 gaagaaatcc gagcgcccct ttatcggcca cggcggcgtg gacgttgtct gttccatccg 481 aacgggcact acctggccac tggctcctca gggggcattg tccgcatctg gggcatcgtg 541 aagggccacc aggtgcgtct gctcagtggc cacatggcga gaatctgctc tctggccttc 601 tccaagtgcg gacgcttctt ggcctctgga ggcgccgata atctggtcat tgtgtgggac 661 ttgccacgcg agcgaatgat ccgctgcctg agccaccaca cggcagccgt caactcttgc 721 gtctttgaca tgaacaataa tctgctggtt gtgggcagcc gggatggccg gctgtccgtc 781 tgggactttg accgcctcgt ccaggagtct ggagcccatg aaaactcgtc ttccgtaccg 841 cccgcagagg agttgccgct taaatcgtat gccaaccatg agggacccat ctgtaaggtt 901 gcctttaaca gcggcaatat catgtttggc gtccgcctgg agtctttcaa gaagtcctag