Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized WD repeat-containing


LOCUS       XM_041591983             960 bp    mRNA    linear   INV 14-MAY-2021
            protein alr3466-like (LOC121403793), mRNA.
ACCESSION   XM_041591983
VERSION     XM_041591983.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..960
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..960
                     /gene="LOC121403793"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:121403793"
     CDS             1..960
                     /gene="LOC121403793"
                     /codon_start=1
                     /product="uncharacterized WD repeat-containing protein
                     alr3466-like"
                     /protein_id="XP_041447917.1"
                     /db_xref="GeneID:121403793"
                     /translation="MGAATQRSPWASQAGQPEERPTFSSPAAGSGRSRKRDFAGHTNA
                     KGLMKVAHALKSGPEQAFLVHVFSVDASKPLEDMTLNTESSDKLVKRSLLGHQGRGLS
                     TAAPFRPTAATFSAARTPIVSRLARHWLKAGTACVWDSEEIRAPLYRPRRRGRCLFHP
                     NGHYLATGSSGGIVRIWGIVKGHQVRLLSGHMARICSLAFSKCGRFLASGGADNLVIV
                     WDLPRERMIRCLSHHTAAVNSCVFDMNNNLLVVGSRDGRLSVWDFDRLVQESGAHENS
                     SSVPPAEELPLKSYANHEGPICKVAFNSGNIMFGVRLESFKKS"
     misc_feature    4..>906
                     /gene="LOC121403793"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    466..570
                     /gene="LOC121403793"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    586..696
                     /gene="LOC121403793"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    709..789
                     /gene="LOC121403793"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atgggagctg ccacgcaacg ctccccctgg gcatcccagg ctggacagcc cgaagaacgc
       61 cccacgttct cgtcgcccgc tgctggttct ggtcgcagtc gcaagagaga tttcgctggt
      121 cacacgaacg ccaaggggct catgaaagtt gcgcacgcct tgaagagtgg cccggagcaa
      181 gccttcctgg tgcacgtctt ctcggtggat gcctcaaagc cgctggagga tatgacgctc
      241 aacaccgaga gttcggacaa gctagtcaag cgcagcttgc tcggccacca ggggaggggg
      301 ctgtctacag ctgcgccttt tcgcccgacg gccgctacct tctcagctgc tcggactccg
      361 attgtttccc gcctggcccg gcattggctc aaggctggaa cggcttgtgt atgggactct
      421 gaagaaatcc gagcgcccct ttatcggcca cggcggcgtg gacgttgtct gttccatccg
      481 aacgggcact acctggccac tggctcctca gggggcattg tccgcatctg gggcatcgtg
      541 aagggccacc aggtgcgtct gctcagtggc cacatggcga gaatctgctc tctggccttc
      601 tccaagtgcg gacgcttctt ggcctctgga ggcgccgata atctggtcat tgtgtgggac
      661 ttgccacgcg agcgaatgat ccgctgcctg agccaccaca cggcagccgt caactcttgc
      721 gtctttgaca tgaacaataa tctgctggtt gtgggcagcc gggatggccg gctgtccgtc
      781 tgggactttg accgcctcgt ccaggagtct ggagcccatg aaaactcgtc ttccgtaccg
      841 cccgcagagg agttgccgct taaatcgtat gccaaccatg agggacccat ctgtaaggtt
      901 gcctttaaca gcggcaatat catgtttggc gtccgcctgg agtctttcaa gaagtcctag