Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura bromodomain-containing protein 2-like


LOCUS       XM_041591982             965 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072432), mRNA.
ACCESSION   XM_041591982
VERSION     XM_041591982.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 63% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..965
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..965
                     /gene="LOC111072432"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 41% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111072432"
     CDS             81..965
                     /gene="LOC111072432"
                     /codon_start=1
                     /product="bromodomain-containing protein 2-like"
                     /protein_id="XP_041447916.1"
                     /db_xref="GeneID:111072432"
                     /translation="MAMRKKKLPLDACKEILVVLLSKKHRDCAWPFYNPVDAEKFGLH
                     DYHDIIKKPMDLGTMKRKMDNRQYTSAAEFAEDMRLMFSNCYKYNPPDHDVVAMGQKL
                     QHVFEALYAGIPDEPVSNAACHTTLAHAHTQGNGQGQGHGGKVSASLNQDGSDSENES
                     RSDAESSSSSSSEEDSAKLKVLQSKLNTTYSKLRDVMAENRKLIQEKKKGWIVGKELR
                     AKERSIDNKQIDLDKQIENLTEEVHALKMKMKRQSEAPGSSSAFSQAQAQTSTPMSST
                     RSGVCSYKNSGGCKSQRN"
     misc_feature    108..410
                     /gene="LOC111072432"
                     /note="Bromodomain, Brdt_like subfamily, repeat II. Human
                     Brdt is a testis-specific member of the BET subfamily of
                     bromodomain proteins; the first bromodomain in Brdt has
                     been shown to be essential for male germ cell
                     differentiation. Bromodomains are 110 amino...; Region:
                     Bromo_Brdt_II_like; cd05498"
                     /db_xref="CDD:99930"
     misc_feature    order(186..188,207..209,216..218,333..335,345..347,
                     363..365)
                     /gene="LOC111072432"
                     /note="acetyllysine binding site [active]"
                     /db_xref="CDD:99930"
ORIGIN      
        1 atagaaaaac cttcgacgaa ggaaactgta accaattcgt aaacaaattc attggcattg
       61 ttacgcagaa ggcagaagaa atggcgatgc gcaagaagaa gcttccactg gacgcttgca
      121 aagaaatcct cgtggttctg ttaagcaaga agcaccgcga ctgtgcgtgg cccttctaca
      181 atccggtgga tgcggagaag tttggcctgc acgactacca cgacataatc aagaagccta
      241 tggacctggg caccatgaag cgcaaaatgg acaaccggca gtacacgagc gcggcggagt
      301 ttgccgaaga tatgcgattg atgttcagta actgctacaa gtacaatccg ccagatcatg
      361 atgttgtggc catgggacag aagctgcagc atgtattcga ggccctctac gctgggatac
      421 ccgacgaacc ggtgtcgaat gcggcatgcc acacaacact ggcccatgct cacactcagg
      481 ggaatgggca ggggcagggg cacggtggca aagtgagcgc ctccctcaat caagacggca
      541 gcgactcgga gaacgagtcc cgctcggacg cagagtcaag ctccagctcc agctcggagg
      601 aagattccgc caagctcaaa gtcctccagt ccaagttgaa cactacctac tcgaaactgc
      661 gcgatgtgat ggcggagaat cgcaagttga tacaggagaa gaagaaaggg tggatcgtcg
      721 gcaaggagct cagggccaag gagagaagca tcgataacaa gcagattgat cttgacaagc
      781 agatcgagaa cctcaccgag gaggttcatg ccttgaagat gaaaatgaag cgacagagcg
      841 aagcccccgg ctccagctcg gcattctccc aggcccaggc ccagacctcg acaccgatgt
      901 cctcaactcg tagcggtgtc tgcagctaca aaaatagtgg agggtgcaag agccagcgca
      961 actaa