Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591977 627 bp mRNA linear INV 14-MAY-2021 phosphatase 1-like (LOC121403888), mRNA. ACCESSION XM_041591977 VERSION XM_041591977.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..627 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..627 /gene="LOC121403888" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:121403888" CDS 1..627 /gene="LOC121403888" /codon_start=1 /product="multiple inositol polyphosphate phosphatase 1-like" /protein_id="XP_041447911.1" /db_xref="GeneID:121403888" /translation="MLKPFPILLLPLLLATLVLVLPQERAVLADPDTQACSSLQREDI ERHLSTKTPYRAIANYDETPPQYAADFTNSIPSLLSTGFAKQGCHPTRIWSVIRHGTR NPSKKVILRAQQRLVELQQRLLSQPHPNLCPAEMEQLRNWSWGHLNAVEDEKLLVAEG EDELIELAERMQLRFPALLPDMYDPAWYYMKFTATQRTLMSAQSFATG" misc_feature 286..>624 /gene="LOC121403888" /note="Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP; cl11399" /db_xref="CDD:472174" ORIGIN 1 atgctaaaac cattcccaat tctgttgctg ccacttctgc tggctacttt agtactggta 61 ctgccacagg agcgggcagt attagccgat cccgataccc aggcttgcag cagtcttcag 121 cgggaagaca tagagcggca cttgtccacc aagacgccct atagggccat agccaattat 181 gacgagacgc cgccgcaata tgcggctgat ttcacgaatt ccattccatc tcttctctcc 241 accggtttcg ccaagcaagg ctgccacccc actcgaatct ggtcggtcat tcgccatggc 301 acccgcaatc ccagcaagaa ggtcattttg cgcgcccagc agcgtctggt cgagttgcag 361 cagcgcctgc tcagccagcc acatcctaat ctctgcccgg ccgaaatgga gcagctccgt 421 aactggagct gggggcacct gaacgccgtc gaggatgaga agctgctggt ggccgagggc 481 gaggatgaac tgatcgagct ggccgaacga atgcagttgc gcttccccgc gctattgcct 541 gatatgtacg acccagcctg gtactacatg aaatttacgg ccacccagag gacgctcatg 601 agcgcccaga gctttgcaac ggggtga