Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura multiple inositol polyphosphate


LOCUS       XM_041591977             627 bp    mRNA    linear   INV 14-MAY-2021
            phosphatase 1-like (LOC121403888), mRNA.
ACCESSION   XM_041591977
VERSION     XM_041591977.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..627
                     /gene="LOC121403888"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:121403888"
     CDS             1..627
                     /gene="LOC121403888"
                     /codon_start=1
                     /product="multiple inositol polyphosphate phosphatase
                     1-like"
                     /protein_id="XP_041447911.1"
                     /db_xref="GeneID:121403888"
                     /translation="MLKPFPILLLPLLLATLVLVLPQERAVLADPDTQACSSLQREDI
                     ERHLSTKTPYRAIANYDETPPQYAADFTNSIPSLLSTGFAKQGCHPTRIWSVIRHGTR
                     NPSKKVILRAQQRLVELQQRLLSQPHPNLCPAEMEQLRNWSWGHLNAVEDEKLLVAEG
                     EDELIELAERMQLRFPALLPDMYDPAWYYMKFTATQRTLMSAQSFATG"
     misc_feature    286..>624
                     /gene="LOC121403888"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:472174"
ORIGIN      
        1 atgctaaaac cattcccaat tctgttgctg ccacttctgc tggctacttt agtactggta
       61 ctgccacagg agcgggcagt attagccgat cccgataccc aggcttgcag cagtcttcag
      121 cgggaagaca tagagcggca cttgtccacc aagacgccct atagggccat agccaattat
      181 gacgagacgc cgccgcaata tgcggctgat ttcacgaatt ccattccatc tcttctctcc
      241 accggtttcg ccaagcaagg ctgccacccc actcgaatct ggtcggtcat tcgccatggc
      301 acccgcaatc ccagcaagaa ggtcattttg cgcgcccagc agcgtctggt cgagttgcag
      361 cagcgcctgc tcagccagcc acatcctaat ctctgcccgg ccgaaatgga gcagctccgt
      421 aactggagct gggggcacct gaacgccgtc gaggatgaga agctgctggt ggccgagggc
      481 gaggatgaac tgatcgagct ggccgaacga atgcagttgc gcttccccgc gctattgcct
      541 gatatgtacg acccagcctg gtactacatg aaatttacgg ccacccagag gacgctcatg
      601 agcgcccaga gctttgcaac ggggtga