Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591972 1261 bp mRNA linear INV 14-MAY-2021 (LOC111081856), mRNA. ACCESSION XM_041591972 VERSION XM_041591972.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 15% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1261 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1261 /gene="LOC111081856" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 85% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111081856" CDS 1..1215 /gene="LOC111081856" /codon_start=1 /product="uncharacterized protein LOC111081856" /protein_id="XP_041447906.1" /db_xref="GeneID:111081856" /translation="MEKSSTGNDQNTVAEMPSTSSALGEQKPLAGTMEKDEAPARCWL ISPDEYSGLGEQTVRQQVRDNAGATLQVNIEDSRFYCIPRLLKCYSVWFASRDWRANK FNFLPSQVPARGFECAYEWLRFQKLPSTADVVYTLQVAKYLKIDLLEPICWAVLNADS LREKAAFMVFRQAKPYPDLQDVCNAMSGRIRNYFLALVGSEYFTELSVDDLENLLKRD SIGVNSEIEVFFLVLRWMNLARHERVQHLGRLMDCVRFSLMPIAFLWTLRDGFTHPDK DHLFSADPMLLAFYTDPKTETIITAALSYVATADAFLGDYDSYLDHMKEHRLPVTYPR KYVYHHQCPYHQLVLGVSGVQLNFKANDIEQYIGGLQELWKGDGPPSHGDELVADAQQ DHFANNAAVVLC" misc_feature 529..792 /gene="LOC111081856" /note="BTB And C-terminal Kelch; Region: BACK; smart00875" /db_xref="CDD:197943" ORIGIN 1 atggaaaaaa gctcgactgg caacgaccag aacaccgtag cggagatgcc gtctaccagt 61 tcggccttgg gggaacagaa gcctcttgct ggaaccatgg aaaaggatga agcaccagct 121 cgctgctggt tgatctctcc cgacgagtat tcgggcttgg gagagcagac ggtgaggcaa 181 caggtgaggg acaacgcggg ggccactttg caggtgaaca tcgaggatag tcggttctac 241 tgcataccaa ggctgctcaa gtgctattcg gtgtggtttg caagccgcga ttggcgtgcc 301 aacaagttca actttttgcc aagtcaggtg ccggccagag ggttcgagtg cgcctacgaa 361 tggttgcgct tccagaagct gcccagcact gcggacgtgg tctatacact ccaggtagcc 421 aagtacctga agattgacct gcttgaaccc atatgctggg cggtgctgaa cgccgatagt 481 ctgcgcgaga aggctgcctt tatggtgttt cggcaggcaa agccataccc ggatctgcag 541 gatgtgtgca atgcgatgag cggaaggatt cgcaattact tcctagcgct cgtggggagc 601 gaatacttca ccgagctatc agttgacgac ctggaaaacc tactcaagcg cgactccatc 661 ggcgtcaact ccgaaataga ggtcttcttc ctggtgctgc gctggatgaa cctggcgcgc 721 cacgaaaggg tgcagcatct gggccgccta atggactgcg ttcgattcag tctcatgccg 781 attgcctttc tgtggacact gcgcgacggt tttacgcacc cggacaagga tcacctcttc 841 tcggccgacc ccatgctgct cgccttctac acggatccca aaaccgaaac gatcattacc 901 gctgccttgt cctacgtagc cacggctgat gctttccttg gcgactatga cagctatttg 961 gatcacatga aagagcatcg tttgccagtg acctatccgc gcaagtacgt ctaccatcac 1021 cagtgcccgt accaccagct cgtgctagga gtttctggcg tacaactaaa tttcaaagcc 1081 aacgacattg aacagtacat cggtggcttg caggagctgt ggaagggaga cgggccgcca 1141 tcgcatgggg acgagttggt cgccgatgcg cagcaggacc acttcgccaa taatgctgca 1201 gttgttttat gttgatttat atctataata aataataact gccgcttact ggaaccaaca 1261 g