Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591969 1102 bp mRNA linear INV 14-MAY-2021 actin-dependent regulator of chromatin subfamily B member 1-A-like (LOC111072411), mRNA. ACCESSION XM_041591969 VERSION XM_041591969.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1102 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1102 /gene="LOC111072411" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111072411" CDS 81..392 /gene="LOC111072411" /codon_start=1 /product="SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A-like" /protein_id="XP_041447903.1" /db_xref="GeneID:111072411" /translation="MSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSIRGQLSWHCRTY AFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTRRMRRLANTTTG W" misc_feature <96..323 /gene="LOC111072411" /note="SNF5 / SMARCB1 / INI1; Region: SNF5; pfam04855" /db_xref="CDD:428158" ORIGIN 1 agagctgtgt ccagcgtgtc atagtcaagc tcaacataca cgtgggcaac acgtcgctcg 61 tcgatcaggt cgagtgggac atgtccgaga agaacaacaa tccggaggag tttgccatca 121 agctctgtgc cgagctggga ttgggtggag agtttgtgac ggccatagca tatagtatac 181 gtggccagtt gtcgtggcac tgtcgcacat acgccttcag cgaggcaccc ctgtccacca 241 tcgatgtgcc attccggaat cccagcgacg cggatgcgtg ggccccattc ctagagacgc 301 taaccgatgc cgagatggag aagaagatcc gagatcaaga caggaatacg cggcgtatgc 361 gacgactggc caacaccaca accggttggt gattatcctc gtccaccatc caaatcgaaa 421 tcctcgacca taccgctcgc catccactcc gatctgaatg ctgtccttac catttttgcc 481 gtgagatcac gcagccaaag atacaaaagc caagccactg caccgcggcc aaaacgaagt 541 acaacacagc cacaacgaaa tatctaatta tttgtattcc atccacccac cgcgcccgcg 601 gatgtttact gtatgggaag cgccttatag cgtagcgctg ccttctgatt gcgtttccgt 661 tcgatcaaca cagaacggaa ggagggcggc gtcagtgtaa actgggcata cactttggtt 721 tggttcctcg ctcttctgtt tggatttaat tagccgctag attggaagat tgcttgatga 781 gatgaggcgg ggtggcttat cgaacccaaa gggtaaacaa aaatgtgtgc tgggagcagc 841 ttccgctgcc atagtcggag ggcgaggcga ggcctcttcg ctggccctgt cggtggcatc 901 aagctcaaag cgcaagcaac gttcgctgag cgcggtgtgg taccagccca agatacagat 961 tctctagcgg atttctctag ataaaaaggg taactttatt gccttcgcga taactaaagc 1021 tatacagaaa gtgtcgtgtg tgttttgttt ttgtgttgtg tgtgtgtgtg caagtggaag 1081 tggaagtgaa tgagatgcga gt