Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura SWI/SNF-related matrix-associated


LOCUS       XM_041591969            1102 bp    mRNA    linear   INV 14-MAY-2021
            actin-dependent regulator of chromatin subfamily B member 1-A-like
            (LOC111072411), mRNA.
ACCESSION   XM_041591969
VERSION     XM_041591969.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1102
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1102
                     /gene="LOC111072411"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111072411"
     CDS             81..392
                     /gene="LOC111072411"
                     /codon_start=1
                     /product="SWI/SNF-related matrix-associated
                     actin-dependent regulator of chromatin subfamily B member
                     1-A-like"
                     /protein_id="XP_041447903.1"
                     /db_xref="GeneID:111072411"
                     /translation="MSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSIRGQLSWHCRTY
                     AFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTRRMRRLANTTTG
                     W"
     misc_feature    <96..323
                     /gene="LOC111072411"
                     /note="SNF5 / SMARCB1 / INI1; Region: SNF5; pfam04855"
                     /db_xref="CDD:428158"
ORIGIN      
        1 agagctgtgt ccagcgtgtc atagtcaagc tcaacataca cgtgggcaac acgtcgctcg
       61 tcgatcaggt cgagtgggac atgtccgaga agaacaacaa tccggaggag tttgccatca
      121 agctctgtgc cgagctggga ttgggtggag agtttgtgac ggccatagca tatagtatac
      181 gtggccagtt gtcgtggcac tgtcgcacat acgccttcag cgaggcaccc ctgtccacca
      241 tcgatgtgcc attccggaat cccagcgacg cggatgcgtg ggccccattc ctagagacgc
      301 taaccgatgc cgagatggag aagaagatcc gagatcaaga caggaatacg cggcgtatgc
      361 gacgactggc caacaccaca accggttggt gattatcctc gtccaccatc caaatcgaaa
      421 tcctcgacca taccgctcgc catccactcc gatctgaatg ctgtccttac catttttgcc
      481 gtgagatcac gcagccaaag atacaaaagc caagccactg caccgcggcc aaaacgaagt
      541 acaacacagc cacaacgaaa tatctaatta tttgtattcc atccacccac cgcgcccgcg
      601 gatgtttact gtatgggaag cgccttatag cgtagcgctg ccttctgatt gcgtttccgt
      661 tcgatcaaca cagaacggaa ggagggcggc gtcagtgtaa actgggcata cactttggtt
      721 tggttcctcg ctcttctgtt tggatttaat tagccgctag attggaagat tgcttgatga
      781 gatgaggcgg ggtggcttat cgaacccaaa gggtaaacaa aaatgtgtgc tgggagcagc
      841 ttccgctgcc atagtcggag ggcgaggcga ggcctcttcg ctggccctgt cggtggcatc
      901 aagctcaaag cgcaagcaac gttcgctgag cgcggtgtgg taccagccca agatacagat
      961 tctctagcgg atttctctag ataaaaaggg taactttatt gccttcgcga taactaaagc
     1021 tatacagaaa gtgtcgtgtg tgttttgttt ttgtgttgtg tgtgtgtgtg caagtggaag
     1081 tggaagtgaa tgagatgcga gt