Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591967 857 bp mRNA linear INV 14-MAY-2021 variant X5, mRNA. ACCESSION XM_041591967 VERSION XM_041591967.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..857 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..857 /gene="LOC121403885" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:121403885" CDS 140..724 /gene="LOC121403885" /codon_start=1 /product="uncharacterized protein LOC121403885 isoform X5" /protein_id="XP_041447901.1" /db_xref="GeneID:121403885" /translation="MDTPWQLQVLLQMLLSWTLAANGHRELFPSLRQGTTASSSATTT LNVLSDAGKFVMLPKVVGGYSITIEQVPFQLSVRRRTMHERAYGLGLICGGALISQRV ACSAAHCYAVWKQHTQPGEVSRSDHVRGGGGQHTNRPGRQAHQGVSGAANHRPQRLQC LLAGERHRAALPQRLRVVAVEGRASHSAGHQGPD" misc_feature 314..>544 /gene="LOC121403885" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl21584" /db_xref="CDD:473915" misc_feature 317..319 /gene="LOC121403885" /note="cleavage site [active]" /db_xref="CDD:238113" ORIGIN 1 tacgaacatc gatacatcca tcagctaccc ggcagcttga aaggcaaaac tttgtttacg 61 ttttgttatt gagctttagt tgagctaaac aaacaaaaca aaaacagggt gccgtgaaga 121 tttgtatgga attattacga tggacacacc gtggcagctg caggtgctct tgcagatgct 181 tctatcgtgg acattggcgg ccaacgggca tcgtgagttg tttccctctc tccgccaggg 241 cacaacagcc tcctcctccg ccacaacaac tctaaacgtg ctctccgatg caggcaagtt 301 cgtgatgctg ccgaaggtgg tgggcggcta ttcgataacg atcgaacagg tcccgttcca 361 gctgtcggtg cgtcgccgga cgatgcacga aagggcatac ggattgggcc tcatctgtgg 421 cggggcattg atctcgcagc gtgtggcctg ctcggcggcc cactgctatg ccgtgtggaa 481 acaacacaca caacccggtg aggtatcacg atccgaccat gttcgtggtg gtggcgggca 541 gcacacaaat cgaccaggcc gacaggcaca ccaaggagta tctggtgcag caaatcatcg 601 cccacagcgc ctacaatgcc tcctcgctgg agaacgacat cgcgctgctc ttcctcaacg 661 gctacgtgtc gtggcagtcg agggccgtgc gagccattcc gctggccacc aaggcccaga 721 ctgagggcac cacgtgcctg atcaatggct ggggtaagat cacaatggtg ggcaaatcgg 781 catcgctgca gcaggcgccg gtgcccatcc tgaacaagag cctctgccgt gccatctaca 841 tgctgccagt gtcccag