Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura trypsin (LOC121403885), transcript


LOCUS       XM_041591966            1320 bp    mRNA    linear   INV 14-MAY-2021
            variant X4, mRNA.
ACCESSION   XM_041591966
VERSION     XM_041591966.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1320
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1320
                     /gene="LOC121403885"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:121403885"
     CDS             71..799
                     /gene="LOC121403885"
                     /codon_start=1
                     /product="trypsin I-P1 isoform X4"
                     /protein_id="XP_041447900.1"
                     /db_xref="GeneID:121403885"
                     /translation="MPCGNNTHNPVRYHDPTMFVVVAGSTQIDQADRHTKEYLVQQII
                     AHSAYNASSLENDIALLFLNGYVSWQSRAVRAIPLATKAQTEGTTCLINGWAANLFPK
                     VGKSASLQQAPVPILNKSLCRAIYMLPVSQLCAGFMQGGIDACQGDSGGPLICDGQLA
                     GIISWGVGCADPGFPGVYTNVSHFVDWIQMVNATLDYSKYTVVGSADLASGAQRTWWL
                     ALAFLLIALGGSWSGGWNLNWNWG"
     misc_feature    101..643
                     /gene="LOC121403885"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    order(497..499,560..562,566..568)
                     /gene="LOC121403885"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 tacggattgg gcctcatctg tggcggggca ttgatctcgc agcgtgtggc ctgctcggcg
       61 gcccactgct atgccgtgtg gaaacaacac acacaacccg gtgaggtatc acgatccgac
      121 catgttcgtg gtggtggcgg gcagcacaca aatcgaccag gccgacaggc acaccaagga
      181 gtatctggtg cagcaaatca tcgcccacag cgcctacaat gcctcctcgc tggagaacga
      241 catcgcgctg ctcttcctca acggctacgt gtcgtggcag tcgagggccg tgcgagccat
      301 tccgctggcc accaaggccc agactgaggg caccacgtgc ctgatcaatg gctgggctgc
      361 gaatctcttc ccgaaggtgg gcaaatcggc atcgctgcag caggcgccgg tgcccatcct
      421 gaacaagagc ctctgccgtg ccatctacat gctgccagtg tcccagctgt gcgctggctt
      481 catgcagggc ggcatcgatg cctgtcaggg tgactctggc ggtcccctaa tctgcgacgg
      541 ccagctggcg ggcatcatct cgtggggcgt gggctgtgcg gatcccggct ttcccggcgt
      601 ctataccaat gtctcgcact ttgttgattg gatccaaatg gtaaacgcca cgctcgacta
      661 ctccaaatac acggtggtgg gctcggcgga tctggccagc ggtgcccaac gtacctggtg
      721 gctggccttg gcatttctgc ttatcgctct gggcgggagc tggagcgggg gctggaactt
      781 gaactggaac tggggctgat gatgtgcggg ccaagatatg gaatgttgga cagcaataat
      841 aaaatcatca ttcagcttgt ctcttctgtc atttaataat ctaatcatct ccgcatacgc
      901 acttgtgtat cgattgccca accatagata cagaaatcga attgccgtat gactaaaagg
      961 gtgacacaat aaccaatttt aatcagccac aaggactggg acagggagtg ggactgggac
     1021 tgggagtgtt gcgcctgccc ctcaagatca aagaccgaga aaacccaacg acctacacct
     1081 acctccaaga cccaacaaat atcgttttaa ctgctcgatt ctgtgggttc caatagataa
     1141 tatttattaa cggataagag cgcattcaat atatctgatt gttatctgat gatatgccaa
     1201 atcaaatcat aattggatca taaatatgta cagacaatac gagaatgaac cgaaaagtac
     1261 aaacctcctt ttggattttt gattgttgca attgccgagc ctcgaacctc ttcaaaatat