Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura glutathione synthetase


LOCUS       XM_041591932             989 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111074813), transcript variant X6, mRNA.
ACCESSION   XM_041591932
VERSION     XM_041591932.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..989
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..989
                     /gene="LOC111074813"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 16 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074813"
     CDS             449..898
                     /gene="LOC111074813"
                     /codon_start=1
                     /product="glutathione synthetase isoform X4"
                     /protein_id="XP_041447866.1"
                     /db_xref="GeneID:111074813"
                     /translation="MSVDPNTPVLRNCIRLPLPEEELLEVTAKAKDYAIMHGAAMRSK
                     TSFSPDSLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAETIK
                     VDEFTANLFNIYRKVLAHGYTQFRAEGTGTCRQAAEYAQEQRPGWTL"
     misc_feature    527..>820
                     /gene="LOC111074813"
                     /note="Eukaryotic glutathione synthase, ATP binding
                     domain; Region: GSH_synth_ATP; pfam03917"
                     /db_xref="CDD:461091"
ORIGIN      
        1 catccctaat attggttttg tgttttggtt ttgttgaaaa tttctgtttg agtttttttt
       61 gccccacccc cctatcaatt tgagatttag tttgtaactt taacaacgcc aaaatcaaaa
      121 aaaaaaatta gcccaaatta tcgtgtaccc gatcgatatc aagggacgac gagtgtaacc
      181 atagaaacag cccagaccga ggcagacctc aagcaaaaga gtggagcaga gccgagcaga
      241 gcagcgaggg cgtgcgtctg gtgacgaaat agagtcgacg gcagagataa cgtttaccac
      301 aagcacaaac cacactaact gtgactgtga ctgctggcat tcagcagcga gcattctcga
      361 agaacaggcg gcaattcagc agcagcagca gcagccagac cagaccagtc ccacagccag
      421 aagaagaagc agaatcagaa tcagaaccat gtccgtcgat cccaacacac ccgtgctgcg
      481 taactgcatt cgcctgcctt tgcccgagga agaattgctc gaggtgacgg ccaaggccaa
      541 ggactatgcc atcatgcacg gtgcggcaat gcgttccaag accagcttca gtccggattc
      601 gctgaacttt gctccgtttg tgctggtccc ctcctcgttt ccgcgcaagg agtttgagaa
      661 ggcggtggcc ctgcagccga tcatcaatcg tctgatgcac aatgtggccc acgatgagga
      721 gttcatcacg accacactgg cggagaccat caaggtggat gagttcaccg ccaatctgtt
      781 taacatctat cgcaaagtgc tggcccatgg ctacacccag tttcgtgctg agggaactgg
      841 gacatgccga caagctgccg aatatgccca agaacaacgc cctggctgga ctctgtgacg
      901 gaatggtcaa ggcctgggat atctatgcca agccgcagtc cgtgatcttg ttcatcattg
      961 aggacgtgtc gtacaacatc tgcgaccag