Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591932 989 bp mRNA linear INV 14-MAY-2021 (LOC111074813), transcript variant X6, mRNA. ACCESSION XM_041591932 VERSION XM_041591932.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..989 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..989 /gene="LOC111074813" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="GeneID:111074813" CDS 449..898 /gene="LOC111074813" /codon_start=1 /product="glutathione synthetase isoform X4" /protein_id="XP_041447866.1" /db_xref="GeneID:111074813" /translation="MSVDPNTPVLRNCIRLPLPEEELLEVTAKAKDYAIMHGAAMRSK TSFSPDSLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAETIK VDEFTANLFNIYRKVLAHGYTQFRAEGTGTCRQAAEYAQEQRPGWTL" misc_feature 527..>820 /gene="LOC111074813" /note="Eukaryotic glutathione synthase, ATP binding domain; Region: GSH_synth_ATP; pfam03917" /db_xref="CDD:461091" ORIGIN 1 catccctaat attggttttg tgttttggtt ttgttgaaaa tttctgtttg agtttttttt 61 gccccacccc cctatcaatt tgagatttag tttgtaactt taacaacgcc aaaatcaaaa 121 aaaaaaatta gcccaaatta tcgtgtaccc gatcgatatc aagggacgac gagtgtaacc 181 atagaaacag cccagaccga ggcagacctc aagcaaaaga gtggagcaga gccgagcaga 241 gcagcgaggg cgtgcgtctg gtgacgaaat agagtcgacg gcagagataa cgtttaccac 301 aagcacaaac cacactaact gtgactgtga ctgctggcat tcagcagcga gcattctcga 361 agaacaggcg gcaattcagc agcagcagca gcagccagac cagaccagtc ccacagccag 421 aagaagaagc agaatcagaa tcagaaccat gtccgtcgat cccaacacac ccgtgctgcg 481 taactgcatt cgcctgcctt tgcccgagga agaattgctc gaggtgacgg ccaaggccaa 541 ggactatgcc atcatgcacg gtgcggcaat gcgttccaag accagcttca gtccggattc 601 gctgaacttt gctccgtttg tgctggtccc ctcctcgttt ccgcgcaagg agtttgagaa 661 ggcggtggcc ctgcagccga tcatcaatcg tctgatgcac aatgtggccc acgatgagga 721 gttcatcacg accacactgg cggagaccat caaggtggat gagttcaccg ccaatctgtt 781 taacatctat cgcaaagtgc tggcccatgg ctacacccag tttcgtgctg agggaactgg 841 gacatgccga caagctgccg aatatgccca agaacaacgc cctggctgga ctctgtgacg 901 gaatggtcaa ggcctgggat atctatgcca agccgcagtc cgtgatcttg ttcatcattg 961 aggacgtgtc gtacaacatc tgcgaccag