Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591929 760 bp mRNA linear INV 14-MAY-2021 (LOC111066299), mRNA. ACCESSION XM_041591929 VERSION XM_041591929.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..760 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..760 /gene="LOC111066299" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:111066299" CDS 174..683 /gene="LOC111066299" /codon_start=1 /product="uncharacterized protein LOC111066299" /protein_id="XP_041447863.1" /db_xref="GeneID:111066299" /translation="MTDTRITPSGASGLCMPSLPSHGLGSDEVCRPHRLTDAPVSSSP ISVFGPRLTCANGLSSRLTAERIAAHMPRRFLWRIRNRSRALCALADLVWLISATWSP SILLLAWLYRCRLSCNGLRSDHLASGMFSVCNSTVLLEGRTIGCSWNATPPVASCSFS RFAADISDI" ORIGIN 1 agtcacccga ttgctccacg gactttcgct cagctcgatt actccaagac gcaacatttc 61 gtcgacttcc gcaaacaaca gctcctgtac cgccggagat actgggccta ctatctgcgg 121 agccaatcca aactttcgcc agaaatcgac ccccagatac agtgattgct tcaatgacgg 181 acacaagaat aactccatcg ggtgcttctg gcctttgtat gccatcacta ccatcacacg 241 gcctaggatc tgatgaggtg tgccgcccgc acaggctcac tgatgccccc gtatcgagca 301 gtcccatcag cgtcttcggg cccagactca cgtgtgcaaa cggcctgtcg tcccggctta 361 ctgcagaacg gattgctgca catatgcccc gtcgtttcct ctggcgtatc cggaatcggt 421 cccgagccct ctgtgctcta gccgacctcg tttggcttat ttccgccacc tggtccccca 481 gtattcttct cctggcctgg ttatatcgct gtcgtctttc ctgtaacggc ttacgctcgg 541 accatctcgc ctcaggtatg ttctctgtat gtaattctac cgtgttgttg gagggcagaa 601 ctattggctg ctcgtggaac gcgacccctc cagttgcgtc gtgctccttc tcccgtttcg 661 cggccgacat ttcggacatt tagggaggat taccccgtca gacccacact tgtaacagaa 721 tatttttcgc acttctgact cacactcaaa atatgtgtgt