Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura peptide transporter family 1-like


LOCUS       XM_041591912            1036 bp    mRNA    linear   INV 14-MAY-2021
            (LOC121403874), mRNA.
ACCESSION   XM_041591912
VERSION     XM_041591912.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1036
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1036
                     /gene="LOC121403874"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 14 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:121403874"
     CDS             21..947
                     /gene="LOC121403874"
                     /codon_start=1
                     /product="peptide transporter family 1-like"
                     /protein_id="XP_041447846.1"
                     /db_xref="GeneID:121403874"
                     /translation="MVFIWQQTYPLMPSSGNTQLRVFSGIPDCSYRFSTNLGARESFT
                     LQGLDLYYSGSLATSNGTFTLTYTIESLTTGCVELQDGTQELYEATAHTLFLRPAHAI
                     TKHWYADDVQKSNRSQSFVRTLANLLATTRVVWTETSSGDVVLDMPARNHDLYELVTG
                     HYDVQVGDHPLTDVSLRAGGVYALVVAQSRDGFVSRLFEVTPPNSMSMLWLIPQYVVM
                     TLGEVMFSVTGLEFSYSQSPPSMKSVLQACWLLTVAFGNVIVVVVAELKIFDSQASEF
                     FLFAGLMFVDMLVFMAIAYFYIPYDEREAVLL"
     misc_feature    <39..911
                     /gene="LOC121403874"
                     /note="Peptide:H+ symporter (also transports b-lactam
                     antibiotics, the antitumor agent, bestatin, and various
                     protease inhibitors); Region: 2A1704; TIGR00926"
                     /db_xref="CDD:273343"
     misc_feature    <606..923
                     /gene="LOC121403874"
                     /note="Major Facilitator Superfamily; Region: MFS;
                     cl28910"
                     /db_xref="CDD:475125"
ORIGIN      
        1 taagaaaact tcccaaattg atggttttta tttggcagca aacctaccca ctcatgccca
       61 gcagcgggaa tacccagctg cgggtcttta gcggcatacc cgactgctcg taccgcttca
      121 gcaccaatct gggggcgcgc gaaagcttca cgctgcaggg cctggacctg tactactcgg
      181 gcagcctggc caccagcaac ggcaccttca cgctcaccta caccatcgag agtctcacca
      241 caggctgcgt tgagctgcag gatggcacac aggagctgta cgaggcaacg gcacacacgc
      301 tctttctgcg gccggcgcac gccatcacca agcactggta cgcggacgat gtgcaaaagt
      361 ccaaccgatc gcagtccttt gtaaggacgc tggccaattt gctggccacc acgcgggtgg
      421 tgtggaccga aacgagcagt ggcgacgtcg tcctggacat gcccgcccgc aaccatgacc
      481 tctacgagct ggttaccgga cactacgacg tccaggtggg cgaccatccg ttgaccgatg
      541 tcagcctgcg ggccggtggc gtatacgcac tggtcgtggc ccagagccgg gatggcttcg
      601 tttcgcgcct gtttgaggtg acgccaccca actcgatgag catgctctgg ctgataccgc
      661 agtatgtggt catgaccctc ggcgaggtga tgttctcggt cactggtttg gagttctcct
      721 actcccagtc gccgcccagc atgaagtccg tgctgcaggc ctgctggctg ctgaccgtcg
      781 cctttggcaa tgtcatcgtt gtggttgtgg cggagctgaa gatcttcgat tcgcaggcca
      841 gcgagttctt cctcttcgcg ggcctcatgt tcgtcgacat gctcgtcttt atggcgattg
      901 cctactttta tataccctac gacgagcggg aggcggtact gttataattt tacaaagtta
      961 atcaagtagt tgccatccgt ataatattcg tactaaaaac ggacatttaa ataaatgcat
     1021 atctatatat ctacat