Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591912 1036 bp mRNA linear INV 14-MAY-2021 (LOC121403874), mRNA. ACCESSION XM_041591912 VERSION XM_041591912.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1036 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1036 /gene="LOC121403874" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:121403874" CDS 21..947 /gene="LOC121403874" /codon_start=1 /product="peptide transporter family 1-like" /protein_id="XP_041447846.1" /db_xref="GeneID:121403874" /translation="MVFIWQQTYPLMPSSGNTQLRVFSGIPDCSYRFSTNLGARESFT LQGLDLYYSGSLATSNGTFTLTYTIESLTTGCVELQDGTQELYEATAHTLFLRPAHAI TKHWYADDVQKSNRSQSFVRTLANLLATTRVVWTETSSGDVVLDMPARNHDLYELVTG HYDVQVGDHPLTDVSLRAGGVYALVVAQSRDGFVSRLFEVTPPNSMSMLWLIPQYVVM TLGEVMFSVTGLEFSYSQSPPSMKSVLQACWLLTVAFGNVIVVVVAELKIFDSQASEF FLFAGLMFVDMLVFMAIAYFYIPYDEREAVLL" misc_feature <39..911 /gene="LOC121403874" /note="Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors); Region: 2A1704; TIGR00926" /db_xref="CDD:273343" misc_feature <606..923 /gene="LOC121403874" /note="Major Facilitator Superfamily; Region: MFS; cl28910" /db_xref="CDD:475125" ORIGIN 1 taagaaaact tcccaaattg atggttttta tttggcagca aacctaccca ctcatgccca 61 gcagcgggaa tacccagctg cgggtcttta gcggcatacc cgactgctcg taccgcttca 121 gcaccaatct gggggcgcgc gaaagcttca cgctgcaggg cctggacctg tactactcgg 181 gcagcctggc caccagcaac ggcaccttca cgctcaccta caccatcgag agtctcacca 241 caggctgcgt tgagctgcag gatggcacac aggagctgta cgaggcaacg gcacacacgc 301 tctttctgcg gccggcgcac gccatcacca agcactggta cgcggacgat gtgcaaaagt 361 ccaaccgatc gcagtccttt gtaaggacgc tggccaattt gctggccacc acgcgggtgg 421 tgtggaccga aacgagcagt ggcgacgtcg tcctggacat gcccgcccgc aaccatgacc 481 tctacgagct ggttaccgga cactacgacg tccaggtggg cgaccatccg ttgaccgatg 541 tcagcctgcg ggccggtggc gtatacgcac tggtcgtggc ccagagccgg gatggcttcg 601 tttcgcgcct gtttgaggtg acgccaccca actcgatgag catgctctgg ctgataccgc 661 agtatgtggt catgaccctc ggcgaggtga tgttctcggt cactggtttg gagttctcct 721 actcccagtc gccgcccagc atgaagtccg tgctgcaggc ctgctggctg ctgaccgtcg 781 cctttggcaa tgtcatcgtt gtggttgtgg cggagctgaa gatcttcgat tcgcaggcca 841 gcgagttctt cctcttcgcg ggcctcatgt tcgtcgacat gctcgtcttt atggcgattg 901 cctactttta tataccctac gacgagcggg aggcggtact gttataattt tacaaagtta 961 atcaagtagt tgccatccgt ataatattcg tactaaaaac ggacatttaa ataaatgcat 1021 atctatatat ctacat