Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591905 957 bp mRNA linear INV 14-MAY-2021 (LOC121403872), mRNA. ACCESSION XM_041591905 VERSION XM_041591905.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..957 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..957 /gene="LOC121403872" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:121403872" CDS 105..932 /gene="LOC121403872" /codon_start=1 /product="uncharacterized protein LOC121403872" /protein_id="XP_041447839.1" /db_xref="GeneID:121403872" /translation="MADRLKDQAASQQPDDEPTEEQLIADAYANVKVLVEAGDQTGYL QIQPTEVHRFMLASYDDVLVEKYTEAKPQELSKWETATALAPLLNRIEPQDEQQLGKI QLDPVTGKRYMLVPIEVNVLVDGEKFCNIFEYLQARQKKHGKALQVKKEALVDMAIEA TAQKTVRQLVDQENTPKEETPKKAQKSPKKASQRMSLKERLARRSQKKQLQGEQTPQE EPQGQTSKESQRLVGYKAVVVVPPIIFSFKAGLGQEAQQHATEPAASSNQQEEEKQV" ORIGIN 1 cagatctagt cagaatcagt cccctaatcc ccaaaaatcc ccaatacact acaagtacca 61 caattgctgt gtggtttttt ctgtaatttg caatccatgc aatcatggct gatcggttga 121 aggaccaagc ggccagtcaa cagccagacg atgagcccac agaggagcaa ctgatcgccg 181 atgcctatgc caatgtcaag gtactggtgg aggctggcga tcagacgggc tatctgcaga 241 tacagccaac ggaggtgcac aggttcatgc tggccagcta cgacgatgtg ctggtcgaga 301 agtacaccga ggcgaaaccg caggagctca gcaagtggga aacggccact gccttggcac 361 cgctgctcaa tcgcattgag ccgcaggacg agcagcagtt gggcaaaatc caactagatc 421 cggtcacggg caagcgctac atgttggtgc ccatcgaagt caatgttctt gtcgatggcg 481 agaagttttg caacatattt gaatatttgc aggcacggca gaagaagcac gggaaggcgt 541 tgcaggtgaa gaaggaggcg cttgtggata tggccattga agccacagca cagaaaacag 601 tcaggcagct ggtggatcag gagaacactc caaaggaaga gactccgaag aaagcacaga 661 agagccccaa gaaggcgtct cagaggatga gcctcaagga gcggcttgca aggaggagcc 721 agaagaagca gcttcaaggg gagcagactc cacaggaaga accacaaggg cagacttcaa 781 aggagtccca gcgcctggtc ggctacaagg cggtggtcgt tgtgcccccc ataatattct 841 ccttcaaagc gggcctcggc caagaggcac agcagcatgc gacggagcca gcagcttctt 901 ccaatcaaca ggaagaagag aagcaagtct agtcgcagct ctcactctca ctcactt