Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC121403871


LOCUS       XM_041591904             597 bp    mRNA    linear   INV 14-MAY-2021
            (LOC121403871), transcript variant X2, mRNA.
ACCESSION   XM_041591904
VERSION     XM_041591904.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..597
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..597
                     /gene="LOC121403871"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 5 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:121403871"
     CDS             132..506
                     /gene="LOC121403871"
                     /codon_start=1
                     /product="uncharacterized protein LOC121403871 isoform X2"
                     /protein_id="XP_041447838.1"
                     /db_xref="GeneID:121403871"
                     /translation="MADRLKDQAASQQPDDEPTEEQLIADAYANVKVLVEAGDQAGYL
                     QIQPTEVHRFMLASYDDVLVEKYTEAKPQELSKWETATALAPLLNRIEPQDEQQLGKI
                     QLDPVTGKRYMHGRRSTRRRCR"
ORIGIN      
        1 acacgtcagt tgacacaccg cacaagtcag atctagtcag aatcagtccc ctaattccca
       61 aaaatcccca atacactaca agtaccacaa ttgctgtgtg gttttttctg taatttgcaa
      121 tccatgcaat catggctgat cggttgaagg accaagcggc cagtcaacag ccagacgatg
      181 agcccacaga ggagcaactg atcgccgatg cctatgccaa tgtcaaggta ctggtggagg
      241 ctggcgatca ggcgggctat ctgcagatac agccaacgga ggtgcacagg ttcatgctgg
      301 ccagctacga cgatgtgctg gtcgagaagt acaccgaggc gaaaccgcag gagctcagca
      361 agtgggaaac ggccactgcc ttggcaccgc tgctcaatcg cattgagccg caggacgagc
      421 agcagttggg caaaatccaa ctagatccgg tcacgggcaa gcgctacatg cacggcagaa
      481 gaagcacgag aaggcgttgc aggtgaagaa ggaggcgctt gtggatatgg ccattgaagc
      541 cacagcacag aaaacagtca ggcagctggt ggatcaggag aacactccaa aggaaga