Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591903 1193 bp mRNA linear INV 14-MAY-2021 (LOC121403871), transcript variant X1, mRNA. ACCESSION XM_041591903 VERSION XM_041591903.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1193 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1193 /gene="LOC121403871" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:121403871" CDS 131..958 /gene="LOC121403871" /codon_start=1 /product="uncharacterized protein LOC121403871 isoform X1" /protein_id="XP_041447837.1" /db_xref="GeneID:121403871" /translation="MADRLKDQAASQQPDDEPTEEQLIADAYANVKVLVEAGDQAGYL QIQPTEVHRFMLASYDDVLVEKYTEAKPQELSKWETATALAPLLNRIEPQDEQQLGKI QLDPVTGKRYMLVPIEVNVLVDGEKFCNIFEYLQARQKKHEKALQVKKEALVDMAIEA TAQKTVRQLVDQENTPKEETQKKAQKSPKKASQRMSLKERPTRRSQKKQLQGEQTPQE EPQGQTSKESQRLVDYKAEVVVPPIIFSVKAGLGQEAQQHATEPAASSNQQEEEKQV" ORIGIN 1 cacgtcagtt gacacaccgc acaagtcaga tctagtcaga atcagtcccc taattcccaa 61 aaatccccaa tacactacaa gtaccacaat tgctgtgtgg ttttttctgt aatttgcaat 121 ccatgcaatc atggctgatc ggttgaagga ccaagcggcc agtcaacagc cagacgatga 181 gcccacagag gagcaactga tcgccgatgc ctatgccaat gtcaaggtac tggtggaggc 241 tggcgatcag gcgggctatc tgcagataca gccaacggag gtgcacaggt tcatgctggc 301 cagctacgac gatgtgctgg tcgagaagta caccgaggcg aaaccgcagg agctcagcaa 361 gtgggaaacg gccactgcct tggcaccgct gctcaatcgc attgagccgc aggacgagca 421 gcagttgggc aaaatccaac tagatccggt cacgggcaag cgctacatgt tggtgcccat 481 cgaagtcaat gttcttgtcg atggcgagaa gttttgcaac atatttgaat atttgcaggc 541 acggcagaag aagcacgaga aggcgttgca ggtgaagaag gaggcgcttg tggatatggc 601 cattgaagcc acagcacaga aaacagtcag gcagctggtg gatcaggaga acactccaaa 661 ggaagagact cagaagaaag cacagaagag ccccaagaag gcgtctcaga ggatgagcct 721 caaggagcgg cctacaaggc ggagccagaa gaagcagctt caaggggagc agactccaca 781 ggaagaacca caagggcaga cttcaaagga gtcccagcgc ctggtcgact acaaggcgga 841 ggtcgttgtg ccccccataa tattctccgt caaagcgggc ctcggccaag aggcacagca 901 gcatgcgacg gagccagcag cttcttccaa tcaacaggaa gaagagaagc aagtctagtc 961 gcagctctca ctctcactca cttcggactc aaagcagaag ccagaggaga gcagaatggc 1021 ctagagaacc gccgggcagc agagcagaat ggattacggc tctaagccat tctgttgtcc 1081 cctgattttc gactacaaat tacagagttt acatttgctg gatcgtcgtt gttgatcttt 1141 gaataaattc agcattctgt tgattgttat acgagtattt ggctgtagct ttc