Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC121403871


LOCUS       XM_041591903            1193 bp    mRNA    linear   INV 14-MAY-2021
            (LOC121403871), transcript variant X1, mRNA.
ACCESSION   XM_041591903
VERSION     XM_041591903.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1193
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1193
                     /gene="LOC121403871"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:121403871"
     CDS             131..958
                     /gene="LOC121403871"
                     /codon_start=1
                     /product="uncharacterized protein LOC121403871 isoform X1"
                     /protein_id="XP_041447837.1"
                     /db_xref="GeneID:121403871"
                     /translation="MADRLKDQAASQQPDDEPTEEQLIADAYANVKVLVEAGDQAGYL
                     QIQPTEVHRFMLASYDDVLVEKYTEAKPQELSKWETATALAPLLNRIEPQDEQQLGKI
                     QLDPVTGKRYMLVPIEVNVLVDGEKFCNIFEYLQARQKKHEKALQVKKEALVDMAIEA
                     TAQKTVRQLVDQENTPKEETQKKAQKSPKKASQRMSLKERPTRRSQKKQLQGEQTPQE
                     EPQGQTSKESQRLVDYKAEVVVPPIIFSVKAGLGQEAQQHATEPAASSNQQEEEKQV"
ORIGIN      
        1 cacgtcagtt gacacaccgc acaagtcaga tctagtcaga atcagtcccc taattcccaa
       61 aaatccccaa tacactacaa gtaccacaat tgctgtgtgg ttttttctgt aatttgcaat
      121 ccatgcaatc atggctgatc ggttgaagga ccaagcggcc agtcaacagc cagacgatga
      181 gcccacagag gagcaactga tcgccgatgc ctatgccaat gtcaaggtac tggtggaggc
      241 tggcgatcag gcgggctatc tgcagataca gccaacggag gtgcacaggt tcatgctggc
      301 cagctacgac gatgtgctgg tcgagaagta caccgaggcg aaaccgcagg agctcagcaa
      361 gtgggaaacg gccactgcct tggcaccgct gctcaatcgc attgagccgc aggacgagca
      421 gcagttgggc aaaatccaac tagatccggt cacgggcaag cgctacatgt tggtgcccat
      481 cgaagtcaat gttcttgtcg atggcgagaa gttttgcaac atatttgaat atttgcaggc
      541 acggcagaag aagcacgaga aggcgttgca ggtgaagaag gaggcgcttg tggatatggc
      601 cattgaagcc acagcacaga aaacagtcag gcagctggtg gatcaggaga acactccaaa
      661 ggaagagact cagaagaaag cacagaagag ccccaagaag gcgtctcaga ggatgagcct
      721 caaggagcgg cctacaaggc ggagccagaa gaagcagctt caaggggagc agactccaca
      781 ggaagaacca caagggcaga cttcaaagga gtcccagcgc ctggtcgact acaaggcgga
      841 ggtcgttgtg ccccccataa tattctccgt caaagcgggc ctcggccaag aggcacagca
      901 gcatgcgacg gagccagcag cttcttccaa tcaacaggaa gaagagaagc aagtctagtc
      961 gcagctctca ctctcactca cttcggactc aaagcagaag ccagaggaga gcagaatggc
     1021 ctagagaacc gccgggcagc agagcagaat ggattacggc tctaagccat tctgttgtcc
     1081 cctgattttc gactacaaat tacagagttt acatttgctg gatcgtcgtt gttgatcttt
     1141 gaataaattc agcattctgt tgattgttat acgagtattt ggctgtagct ttc