Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura adenylate cyclase,


LOCUS       XM_041591902             570 bp    mRNA    linear   INV 14-MAY-2021
            terminal-differentiation specific-like (LOC121403870), transcript
            variant X2, mRNA.
ACCESSION   XM_041591902
VERSION     XM_041591902.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..570
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..570
                     /gene="LOC121403870"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 5 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:121403870"
     CDS             105..479
                     /gene="LOC121403870"
                     /codon_start=1
                     /product="uncharacterized protein LOC121403870 isoform X2"
                     /protein_id="XP_041447836.1"
                     /db_xref="GeneID:121403870"
                     /translation="MADRLKDQAASQQPDDEPTEEQLIADAYANVKVLVEAGDQTGYL
                     QIQPTEVHRFMLASYDDVLVEKYTEAKPQELSKWETATALAPLLNRIEPQDEQQLGKI
                     QLDPVTGKRYMHGRRSTRRRCR"
ORIGIN      
        1 cagatctagt cagaatcagt cccctaatcc ccaaaaatcc ccaatacact acaagtacca
       61 caattgctgt gtggtttttt ctgtaatttg caatccatgc aatcatggct gatcggttga
      121 aggaccaagc ggccagtcaa cagccagacg atgagcccac agaggagcaa ctgatcgccg
      181 atgcctatgc caatgtcaag gtactggtgg aggctggcga tcagacgggc tatctgcaga
      241 tacagccaac ggaggtgcac aggttcatgc tggccagcta cgacgatgtg ctggtcgaga
      301 agtacaccga ggcgaaaccg caggagctca gcaagtggga aacggccact gccttggcac
      361 cgctgctcaa tcgcattgag ccgcaggacg agcagcagtt gggcaaaatc caactagatc
      421 cggtcacggg caagcgctac atgcacggca gaagaagcac gagaaggcgt tgcaggtgaa
      481 gaaggaggcg cttgtggata tggccattga agccacagca cagaaaacag tcaggcagct
      541 ggtggatcag gagaacactc caaaggaaga