Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura potassium voltage-gated channel


LOCUS       XM_041591899             991 bp    mRNA    linear   INV 14-MAY-2021
            protein Shaker (LOC111074807), transcript variant X7, mRNA.
ACCESSION   XM_041591899
VERSION     XM_041591899.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..991
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..991
                     /gene="LOC111074807"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 4 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074807"
     CDS             16..918
                     /gene="LOC111074807"
                     /codon_start=1
                     /product="potassium voltage-gated channel protein Shaker
                     isoform X7"
                     /protein_id="XP_041447833.1"
                     /db_xref="GeneID:111074807"
                     /translation="MDAMDAMDAMELSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDH
                     DFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRPSFDA
                     ILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLPDNEK
                     QRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTNGTKI
                     EEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAIIPYFI
                     TLATVVAEEEDTLNLPKAPVSPQV"
     misc_feature    157..537
                     /gene="LOC111074807"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain superfamily; Region:
                     BTB_POZ; cl38908"
                     /db_xref="CDD:453885"
     misc_feature    544..>852
                     /gene="LOC111074807"
                     /note="Ion transport protein; Region: Ion_trans;
                     pfam00520"
                     /db_xref="CDD:459842"
ORIGIN      
        1 acattctcat ccgccatgga tgccatggac gccatggatg ccatggagtt gtctttgccc
       61 aaattgagca gtcaagacga agaagggggg gctggtcatg gctttggtgg cggaccgcaa
      121 cactttgaac ccattcctca cgatcatgat ttctgcgaga gagtcgttat aaatgtaagc
      181 gggctgaggt ttgagacaca actacgtacg cttaaccaat tcccggacac gctgctcggg
      241 gatccggctc ggagattacg gtactttgac ccgcttagaa atgaatattt ttttgaccgt
      301 agtcgaccga gcttcgatgc gattttatac tattatcaga gtggtggccg actacggaga
      361 ccggtcaatg tccctttaga cgtatttagt gaagaaataa aattttatga attaggtgat
      421 caagcaatta ataaattcag agaggatgaa ggctttatta aagaggaaga aagaccatta
      481 ccggataatg agaaacaaag aaaagtctgg ctgctcttcg agtatccaga gagttcacaa
      541 gccgccagag ttgtagccat aattagtgta tttgttatat tgctatcaat tgttatattt
      601 tgtctagaaa cattacccga atttaagcat tacaaggtgt tcaatacaac aacaaatggc
      661 acaaagatcg aggaagacga ggtgcctgac atcacagatc ctttcttcct tatagaaacg
      721 ttatgtatta tttggtttac atttgaacta actgtcaggt tcctcgcatg tccgaacaaa
      781 ttaaatttct gcagggatgt catgaatgtt atcgacataa tcgccatcat tccgtacttt
      841 ataacactag cgactgtcgt tgccgaagag gaggatacgt taaatcttcc aaaagcgcca
      901 gtcagtccac aggtatgaga ttctgtttgc ccaatactct tatcttcacg cacacccaca
      961 aacacacaga tacacacatg catatatcac a