Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591898 1003 bp mRNA linear INV 14-MAY-2021 protein Shaker (LOC111074807), transcript variant X6, mRNA. ACCESSION XM_041591898 VERSION XM_041591898.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1003 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1003 /gene="LOC111074807" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:111074807" CDS 16..930 /gene="LOC111074807" /codon_start=1 /product="potassium voltage-gated channel protein Shaker isoform X6" /protein_id="XP_041447832.1" /db_xref="GeneID:111074807" /translation="MAHITTTNGSLSQAPRSLPKLSSQDEEGGAGHGFGGGPQHFEPI PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRP SFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLP DNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTN GTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAII PYFITLATVVAEEEDTLNLPKAPVSPQV" misc_feature 169..549 /gene="LOC111074807" /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain superfamily; Region: BTB_POZ; cl38908" /db_xref="CDD:453885" misc_feature 556..>864 /gene="LOC111074807" /note="Ion transport protein; Region: Ion_trans; pfam00520" /db_xref="CDD:459842" ORIGIN 1 taatggattg cctgtatggc ccacatcacg acgacgaacg gcagtttaag ccaagcgcca 61 aggtctttgc ccaaattgag cagtcaagac gaagaagggg gggctggtca tggctttggt 121 ggcggaccgc aacactttga acccattcct cacgatcatg atttctgcga gagagtcgtt 181 ataaatgtaa gcgggctgag gtttgagaca caactacgta cgcttaacca attcccggac 241 acgctgctcg gggatccggc tcggagatta cggtactttg acccgcttag aaatgaatat 301 ttttttgacc gtagtcgacc gagcttcgat gcgattttat actattatca gagtggtggc 361 cgactacgga gaccggtcaa tgtcccttta gacgtattta gtgaagaaat aaaattttat 421 gaattaggtg atcaagcaat taataaattc agagaggatg aaggctttat taaagaggaa 481 gaaagaccat taccggataa tgagaaacaa agaaaagtct ggctgctctt cgagtatcca 541 gagagttcac aagccgccag agttgtagcc ataattagtg tatttgttat attgctatca 601 attgttatat tttgtctaga aacattaccc gaatttaagc attacaaggt gttcaataca 661 acaacaaatg gcacaaagat cgaggaagac gaggtgcctg acatcacaga tcctttcttc 721 cttatagaaa cgttatgtat tatttggttt acatttgaac taactgtcag gttcctcgca 781 tgtccgaaca aattaaattt ctgcagggat gtcatgaatg ttatcgacat aatcgccatc 841 attccgtact ttataacact agcgactgtc gttgccgaag aggaggatac gttaaatctt 901 ccaaaagcgc cagtcagtcc acaggtatga gattctgttt gcccaatact cttatcttca 961 cgcacaccca caaacacaca gatacacaca tgcatatatc aca