Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura potassium voltage-gated channel


LOCUS       XM_041591898            1003 bp    mRNA    linear   INV 14-MAY-2021
            protein Shaker (LOC111074807), transcript variant X6, mRNA.
ACCESSION   XM_041591898
VERSION     XM_041591898.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1003
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1003
                     /gene="LOC111074807"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074807"
     CDS             16..930
                     /gene="LOC111074807"
                     /codon_start=1
                     /product="potassium voltage-gated channel protein Shaker
                     isoform X6"
                     /protein_id="XP_041447832.1"
                     /db_xref="GeneID:111074807"
                     /translation="MAHITTTNGSLSQAPRSLPKLSSQDEEGGAGHGFGGGPQHFEPI
                     PHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDRSRP
                     SFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEERPLP
                     DNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNTTTN
                     GTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDIIAII
                     PYFITLATVVAEEEDTLNLPKAPVSPQV"
     misc_feature    169..549
                     /gene="LOC111074807"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain superfamily; Region:
                     BTB_POZ; cl38908"
                     /db_xref="CDD:453885"
     misc_feature    556..>864
                     /gene="LOC111074807"
                     /note="Ion transport protein; Region: Ion_trans;
                     pfam00520"
                     /db_xref="CDD:459842"
ORIGIN      
        1 taatggattg cctgtatggc ccacatcacg acgacgaacg gcagtttaag ccaagcgcca
       61 aggtctttgc ccaaattgag cagtcaagac gaagaagggg gggctggtca tggctttggt
      121 ggcggaccgc aacactttga acccattcct cacgatcatg atttctgcga gagagtcgtt
      181 ataaatgtaa gcgggctgag gtttgagaca caactacgta cgcttaacca attcccggac
      241 acgctgctcg gggatccggc tcggagatta cggtactttg acccgcttag aaatgaatat
      301 ttttttgacc gtagtcgacc gagcttcgat gcgattttat actattatca gagtggtggc
      361 cgactacgga gaccggtcaa tgtcccttta gacgtattta gtgaagaaat aaaattttat
      421 gaattaggtg atcaagcaat taataaattc agagaggatg aaggctttat taaagaggaa
      481 gaaagaccat taccggataa tgagaaacaa agaaaagtct ggctgctctt cgagtatcca
      541 gagagttcac aagccgccag agttgtagcc ataattagtg tatttgttat attgctatca
      601 attgttatat tttgtctaga aacattaccc gaatttaagc attacaaggt gttcaataca
      661 acaacaaatg gcacaaagat cgaggaagac gaggtgcctg acatcacaga tcctttcttc
      721 cttatagaaa cgttatgtat tatttggttt acatttgaac taactgtcag gttcctcgca
      781 tgtccgaaca aattaaattt ctgcagggat gtcatgaatg ttatcgacat aatcgccatc
      841 attccgtact ttataacact agcgactgtc gttgccgaag aggaggatac gttaaatctt
      901 ccaaaagcgc cagtcagtcc acaggtatga gattctgttt gcccaatact cttatcttca
      961 cgcacaccca caaacacaca gatacacaca tgcatatatc aca