Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura potassium voltage-gated channel


LOCUS       XM_041591897            1068 bp    mRNA    linear   INV 14-MAY-2021
            protein Shaker (LOC111074807), transcript variant X5, mRNA.
ACCESSION   XM_041591897
VERSION     XM_041591897.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1068
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1068
                     /gene="LOC111074807"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 3 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074807"
     CDS             72..995
                     /gene="LOC111074807"
                     /codon_start=1
                     /product="potassium voltage-gated channel protein Shaker
                     isoform X5"
                     /protein_id="XP_041447831.1"
                     /db_xref="GeneID:111074807"
                     /translation="MHGATNVRSPAEMRHKKKRSLPKLSSQDEEGGAGHGFGGGPQHF
                     EPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLRYFDPLRNEYFFDR
                     SRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINKFREDEGFIKEEER
                     PLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLETLPEFKHYKVFNT
                     TTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKLNFCRDVMNVIDII
                     AIIPYFITLATVVAEEEDTLNLPKAPVSPQV"
     misc_feature    234..614
                     /gene="LOC111074807"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain superfamily; Region:
                     BTB_POZ; cl38908"
                     /db_xref="CDD:453885"
     misc_feature    621..>929
                     /gene="LOC111074807"
                     /note="Ion transport protein; Region: Ion_trans;
                     pfam00520"
                     /db_xref="CDD:459842"
ORIGIN      
        1 ccaggccaag ttgagttcgt gggtcgtcgc gtgcgtgccg gataaaaacc acaaagctgg
       61 tgtctggaat tatgcatggg gcgaccaatg tgcgctcgcc agcagagatg cgtcacaaga
      121 agaagaggtc tttgcccaaa ttgagcagtc aagacgaaga agggggggct ggtcatggct
      181 ttggtggcgg accgcaacac tttgaaccca ttcctcacga tcatgatttc tgcgagagag
      241 tcgttataaa tgtaagcggg ctgaggtttg agacacaact acgtacgctt aaccaattcc
      301 cggacacgct gctcggggat ccggctcgga gattacggta ctttgacccg cttagaaatg
      361 aatatttttt tgaccgtagt cgaccgagct tcgatgcgat tttatactat tatcagagtg
      421 gtggccgact acggagaccg gtcaatgtcc ctttagacgt atttagtgaa gaaataaaat
      481 tttatgaatt aggtgatcaa gcaattaata aattcagaga ggatgaaggc tttattaaag
      541 aggaagaaag accattaccg gataatgaga aacaaagaaa agtctggctg ctcttcgagt
      601 atccagagag ttcacaagcc gccagagttg tagccataat tagtgtattt gttatattgc
      661 tatcaattgt tatattttgt ctagaaacat tacccgaatt taagcattac aaggtgttca
      721 atacaacaac aaatggcaca aagatcgagg aagacgaggt gcctgacatc acagatcctt
      781 tcttccttat agaaacgtta tgtattattt ggtttacatt tgaactaact gtcaggttcc
      841 tcgcatgtcc gaacaaatta aatttctgca gggatgtcat gaatgttatc gacataatcg
      901 ccatcattcc gtactttata acactagcga ctgtcgttgc cgaagaggag gatacgttaa
      961 atcttccaaa agcgccagtc agtccacagg tatgagattc tgtttgccca atactcttat
     1021 cttcacgcac acccacaaac acacagatac acacatgcat atatcaca