Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591896 1108 bp mRNA linear INV 14-MAY-2021 protein Shaker (LOC111074807), transcript variant X4, mRNA. ACCESSION XM_041591896 VERSION XM_041591896.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1108 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1108 /gene="LOC111074807" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:111074807" CDS 73..1035 /gene="LOC111074807" /codon_start=1 /product="potassium voltage-gated channel protein Shaker isoform X4" /protein_id="XP_041447830.1" /db_xref="GeneID:111074807" /translation="MHGATNVRSPAEMRHKKKRQKQFVMQDNYRMMSLPKLSSQDEEG GAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPDTLLGDPARRLR YFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFYELGDQAINK FREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLSIVIFCLE TLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLACPNKL NFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQV" misc_feature 274..654 /gene="LOC111074807" /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain superfamily; Region: BTB_POZ; cl38908" /db_xref="CDD:453885" misc_feature 661..>969 /gene="LOC111074807" /note="Ion transport protein; Region: Ion_trans; pfam00520" /db_xref="CDD:459842" ORIGIN 1 cccaggccaa gttgagttcg tgggtcgtcg cgtgcgtgcc ggataaaaac cacaaagctg 61 gtgtctggaa ttatgcatgg ggcgaccaat gtgcgctcgc cagcagagat gcgtcacaag 121 aagaagaggc aaaagcagtt cgtcatgcag gacaactata ggatgatgtc tttgcccaaa 181 ttgagcagtc aagacgaaga agggggggct ggtcatggct ttggtggcgg accgcaacac 241 tttgaaccca ttcctcacga tcatgatttc tgcgagagag tcgttataaa tgtaagcggg 301 ctgaggtttg agacacaact acgtacgctt aaccaattcc cggacacgct gctcggggat 361 ccggctcgga gattacggta ctttgacccg cttagaaatg aatatttttt tgaccgtagt 421 cgaccgagct tcgatgcgat tttatactat tatcagagtg gtggccgact acggagaccg 481 gtcaatgtcc ctttagacgt atttagtgaa gaaataaaat tttatgaatt aggtgatcaa 541 gcaattaata aattcagaga ggatgaaggc tttattaaag aggaagaaag accattaccg 601 gataatgaga aacaaagaaa agtctggctg ctcttcgagt atccagagag ttcacaagcc 661 gccagagttg tagccataat tagtgtattt gttatattgc tatcaattgt tatattttgt 721 ctagaaacat tacccgaatt taagcattac aaggtgttca atacaacaac aaatggcaca 781 aagatcgagg aagacgaggt gcctgacatc acagatcctt tcttccttat agaaacgtta 841 tgtattattt ggtttacatt tgaactaact gtcaggttcc tcgcatgtcc gaacaaatta 901 aatttctgca gggatgtcat gaatgttatc gacataatcg ccatcattcc gtactttata 961 acactagcga ctgtcgttgc cgaagaggag gatacgttaa atcttccaaa agcgccagtc 1021 agtccacagg tatgagattc tgtttgccca atactcttat cttcacgcac acccacaaac 1081 acacagatac acacatgcat atatcaca