PREDICTED: Drosophila obscura trypsin zeta-like (LOC111081607),

LOCUS       XM_022377715            1059 bp    mRNA    linear   INV 14-MAY-2021
            mRNA.
ACCESSION   XM_022377715
VERSION     XM_022377715.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022377715.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1059
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1059
                     /gene="LOC111081607"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 4 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111081607"
     CDS             46..1005
                     /gene="LOC111081607"
                     /codon_start=1
                     /product="trypsin zeta-like"
                     /protein_id="XP_022233407.2"
                     /db_xref="GeneID:111081607"
                     /translation="MQLLLLLWLVMLPASSIGTEEEQFEEEEPFPRATAAASIGHLAS
                     LRMLKMERRRFGAGHICAGSLIRVNAVLTAAQCFVDREIFDGSFLPISEFVVVLGTPH
                     RFAGSPNTMIFGLKHRVLMQDKFDVKFHEMDLAVLILTRSVAQQHAVVKPIELADRPF
                     KRATECQMSGWGRSPSGFSSAVAVSVGIPIIGPRICLIKQTTQEFFVQPGMLCANQLG
                     KLKRGYCTGDAGGSLVCEGQLAGIVSWGVRCDTPHHPGIFTDVLYYAQWINDSLDNPT
                     QLDDYFGNIAKPLACGAHPGQEILFQWIHFVLFDIYFIMAAVQ"
     misc_feature    202..855
                     /gene="LOC111081607"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    order(271..273,442..444,730..732)
                     /gene="LOC111081607"
                     /note="active site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 cactcaattc aaatacgtcc ctgcaacaat actgccccgt gccccatgca gcttctgttg
       61 ctgctctggc tagtgatgct cccagcgagc agcattggca ctgaggaaga acaatttgag
      121 gaggaggaac catttccaag agcgacagct gccgcatcga tcggtcatct ggcctcgctg
      181 cgaatgctga aaatggagcg cagacgattt ggggctggcc acatctgtgc aggctccctg
      241 atccgcgtca atgcagtgct gaccgccgcc caatgctttg tggaccggga gatctttgat
      301 ggcagctttc tgcccatttc cgagtttgtg gtggtgctgg gcacgcccca ccgcttcgcg
      361 ggcagcccca acaccatgat ctttgggctg aaacatcgcg tcctaatgca ggacaagttc
      421 gatgtgaaat tccacgaaat ggacttggcc gtgctcatcc tcacgagatc cgtggcccag
      481 cagcacgctg tggtgaagcc aatagagctc gccgatcgac cctttaaacg tgccaccgaa
      541 tgccaaatgt ccggctgggg ccgcagccca agcggcttta gttctgcggt ggccgtgtcc
      601 gtaggcatac caatcattgg gccccgcata tgcctcatca agcagacgac gcaggagttt
      661 ttcgtgcagc cgggcatgct gtgtgccaat caattgggca agttgaaacg cggctactgt
      721 accggggacg cgggcggttc gctggtgtgc gagggtcagc tggcgggcat cgtgtcttgg
      781 ggcgttagat gcgacacgcc ccaccatccc ggcatcttca cggatgtgct gtactatgcc
      841 caatggataa atgacagtct ggacaacccc acccaactgg acgactactt tgggaatatc
      901 gccaagccac tggcctgtgg cgcccacccc gggcaggaga ttctgtttca gtggattcat
      961 tttgtactat ttgacatata ttttataatg gcagcagtgc aatagtactg ctatccggcc
     1021 cggggccata gcgtatacga aatatatctt aagaatctt