Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022377714 1213 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022377714 VERSION XM_022377714.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022377714.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1213 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1213 /gene="LOC111081606" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns" /db_xref="GeneID:111081606" CDS 75..1127 /gene="LOC111081606" /codon_start=1 /product="trypsin-2" /protein_id="XP_022233406.2" /db_xref="GeneID:111081606" /translation="MVPISIQLWATTLAIIFLLPTALNGGSVPTAGEARAIRPRFDVD PGRIINGTEATMEATRHQVGLRRALNDGYYFGTGHICGGALIRHNWVLTAAHCFVDQE IYDGTFVAKEKFIVVMGNVDRFNRTNSLTFEIDLLVLQLDKFDLSTYDRDIALLRLND SVPSNHPTIRPIDITALAVPADTVCQVTGWGYTEAGYTSDYLMTVDVPMISEAVCIND SDLGHLIKPGMVCAGYLEQGERDACSGDSGGPLVCRSQLAGIVSWGIGCAEPNLPGVY TEVSYYHDWILEQIGEEGEASGEGSGEGSGEGSGDGEGEGSGDGDGGGAKAALAGVLS LLLPGLLSMRLFSSHL" misc_feature 213..932 /gene="LOC111081606" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 216..218 /gene="LOC111081606" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(360..362,528..530,813..815) /gene="LOC111081606" /note="active site" /db_xref="CDD:238113" misc_feature order(795..797,858..860,864..866) /gene="LOC111081606" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 cgcggttggg gtccggttcc gccctggccc agccattagt ttggattgcc acgtcgggca 61 gctagcaacg caaaatggtt ccgatatcga tacaactctg ggcgacgaca ttggccatca 121 tcttcctgct gcccacggcc ctaaatggtg gctctgtgcc aacggctggc gaggctagag 181 cgattcgtcc tcgcttcgat gtggatccgg gcaggattat caatggcact gaggccacca 241 tggaggccac caggcatcag gtgggactga ggagggccct caacgatggc tactactttg 301 gcacgggtca catctgtggt ggagctctga tccgtcacaa ctgggtgctc actgccgccc 361 attgctttgt ggatcaggag atctacgacg gcaccttcgt ggccaaggag aagttcattg 421 tggtgatggg caacgtggat cgcttcaatc gcaccaactc gctgaccttc gagattgatc 481 tgctcgtcct gcagctggac aagtttgatc tgagcaccta cgacagggac attgccctgc 541 tgcggctgaa cgactcagtg ccgagcaatc atcccaccat acggcccatc gatatcaccg 601 cgctggcagt gccagcggac accgtttgcc aggtgacggg ctggggctac acggaggctg 661 gctacacctc ggactacctc atgaccgtcg atgtgcccat gatcagtgag gcggtgtgca 721 tcaacgacag cgatctgggg cacctgatca agcccggcat ggtgtgtgcc ggctatctgg 781 agcagggcga acgggatgcc tgcagtggcg attcgggggg tccactcgtc tgccgcagcc 841 agctggccgg catcgtatcc tggggcattg gctgtgccga gcccaatttg ccgggcgtct 901 acacggaggt ctcctactac cacgactgga tactggagca gatcggcgag gagggggagg 961 cgagtgggga gggtagtggc gagggcagtg gcgagggaag tggtgacggt gaaggtgagg 1021 gaagtggaga tggagatggc ggtggtgcca aggcagccct cgctggcgtc cttagcctcc 1081 tcctgcctgg cctcctctcc atgaggttat tttcaagcca tctctagtgt tctctcgccc 1141 gctttctctc tcttttagta gcaaataaaa tttgtatcta ttacttaagg aaatgtctct 1201 gataaaaaaa ctc