Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022377712 1138 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022377712 VERSION XM_022377712.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022377712.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1138 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1138 /gene="LOC111081604" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns" /db_xref="GeneID:111081604" CDS 114..1055 /gene="LOC111081604" /codon_start=1 /product="trypsin eta" /protein_id="XP_022233404.2" /db_xref="GeneID:111081604" /translation="MHPLWFSAIVAAVVVLLGPTVASTESSNSTQLLQPKVVGGTAID ITAAPYTVSVRLTSRDRRKFGSGHMCGGVLISQRLVATAAHCCYNSDTSQYRAAGEYV LVMGGTYLASKTNETLVYYVQQLIVHSSYDHGSLTNDIALMFINGYVPWTWPTAKALA LNNQSLDVATACVITGWGVLISGGSSSNTLQTATVPTVSYPTCYLAYPPYVPRSQICA GYTSGGIDACQGDSGGPLMCNNRLSGLVSYGDGCAKPNAPGVYTNVSYFQGWIVQQNN SLNYSIYRNGGVGHGHSAGFAFALLSAICVVAAGLLR" misc_feature 222..935 /gene="LOC111081604" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 222..224 /gene="LOC111081604" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(366..368,528..530,807..809) /gene="LOC111081604" /note="active site" /db_xref="CDD:238113" misc_feature order(789..791,852..854,858..860) /gene="LOC111081604" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 aacggttctg catcggcaaa cgagtccaaa acggacgaaa cggatcttcc cgcgttcgct 61 gttcacttat aaatattttt ttgattgttc ttcttttgtt tttgttgtgt caaatgcatc 121 ccctgtggtt cagtgccata gtggcggcgg tggtagtgct gcttggcccc acggttgcct 181 ccactgaaag cagcaactcc acccaactgc tgcagccaaa ggttgtgggt ggaacggcca 241 ttgacattac tgcagccccg tacacagtct cggtgcgtct gacgtccagg gatcgtcgca 301 aattcggatc gggtcacatg tgcggcggcg tgctcatctc ccagcgcctg gtggccacgg 361 ctgcccactg ctgctacaac tcggacacca gtcaatatcg agcggccggc gagtacgttc 421 tagtcatggg cggcacctat ctggcaagca aaaccaatga gacactggtg tattatgtgc 481 agcagctgat cgttcacagc agctacgacc acggctcgct gaccaacgac attgcgctga 541 tgttcatcaa tggctacgta ccctggacgt ggccgacagc gaaggccctg gccctgaaca 601 atcagtcgct ggatgtcgcc accgcgtgtg tgatcaccgg ctggggagta ctcatctctg 661 gcggctccag cagcaatacg ctgcagacgg ccacagtgcc gacggtcagt tatccgacct 721 gctatttggc ctaccccccg tacgtgccca gatcacagat ctgcgccggc tacacgagcg 781 gcggcatcga tgcgtgccag ggcgactccg ggggaccgct aatgtgcaat aatcggctgt 841 ccggtctcgt gtcctatggc gatggctgtg ccaagcccaa tgcgcccggc gtctacacca 901 atgtgtccta tttccaaggc tggattgtcc agcagaacaa ttcgctcaac tactcgattt 961 accgcaatgg cggcgtgggc cacggtcaca gcgcaggttt cgcctttgcg ctgctgtccg 1021 ccatctgtgt agtggccgct ggattattgc ggtaacgtga ctgggatagc agaattaaca 1081 cgcttattta tgtatgtatg taggaaaata aatgaattta attgaattgg agagctca