Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022371738 1000 bp mRNA linear INV 14-MAY-2021 (LOC111077456), mRNA. ACCESSION XM_022371738 VERSION XM_022371738.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022371738.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1000 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1000 /gene="LOC111077456" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111077456" CDS 79..861 /gene="LOC111077456" /codon_start=1 /product="uncharacterized protein LOC111077456" /protein_id="XP_022227430.2" /db_xref="GeneID:111077456" /translation="MANKSVPVKKVLSPLQPAITSDMVNKLQQTPASEAKISGSVASA WRSPQLMIVFEDGDLHSARQHLLDSLQNPFAEGAVATVLLQESVRDQFVGLVAQNLKR LEPQVAGHPSYVRTLAQIELLKANVIKAEGDVPADASPLLVSDFVSSYLGQPGPTGAI TLQTFRTAREATLVNLKESVPYARVSIWNEKLACAYEVLGHLAVDTFTINCFNPDLSP IRSAFEANQNDVCLFKGYHYETLTVNFKRRIVVFPVGTMFAN" misc_feature 208..852 /gene="LOC111077456" /note="NAD(P)+-dependent aldehyde dehydrogenase superfamily; Region: ALDH-SF; cl11961" /db_xref="CDD:448367" ORIGIN 1 gagctgctga taacgcgatc agacgacgcc ttgatacggt ttcaatttct ttgtgaaaat 61 cggtgaacag agcaaggaat ggccaacaag tccgtgccgg tgaaaaaagt actcagccca 121 ctccagccag cgatcaccag cgacatggtc aacaagctgc agcagacgcc ggcgtccgag 181 gcgaagattt cgggaagcgt ggcttctgcg tggcggtccc cccagctgat gatcgtgttc 241 gaggacggcg atctgcactc ggcccggcag cacctgctcg actcgctgca aaacccgttc 301 gcggagggag ccgtggccac ggtgctgctg caggaaagcg ttcgggatca gtttgtgggc 361 ctggtggccc agaacctcaa gcgactggag ccacaggtgg ccggacatcc cagctacgtg 421 cgcaccctgg cccagatcga gctgctcaag gccaatgtga tcaaagctga gggagatgtc 481 ccagccgatg catcgcccct gctggtgtct gactttgtaa gcagctatct ggggcagccg 541 ggccccactg gcgccattac cctgcaaacc ttccgcactg cgcgcgaggc cacgctggtg 601 aatttgaagg agtcggtgcc ctacgccagg gtcagcatct ggaacgagaa gctggcctgt 661 gcatacgaag tgctcggcca cctggccgtc gacaccttca cgatcaactg cttcaacccg 721 gacctaagtc ccatccgatc ggcgttcgag gccaatcaaa acgatgtttg cctgttcaag 781 ggctatcact acgagacgct gacagtgaac tttaagcgcc ggatcgtcgt cttcccggtg 841 ggaaccatgt tcgccaacta attttgatct ggagttggaa ttggactggg attcctattc 901 aacaaggtgc ttgatcaatc atgccataca tatttacccc ttttgtaact gttttttgta 961 cttataattg ttcaatacac gcgttgcatg acccaaccga