Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111077456


LOCUS       XM_022371738            1000 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111077456), mRNA.
ACCESSION   XM_022371738
VERSION     XM_022371738.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371738.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1000
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1000
                     /gene="LOC111077456"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111077456"
     CDS             79..861
                     /gene="LOC111077456"
                     /codon_start=1
                     /product="uncharacterized protein LOC111077456"
                     /protein_id="XP_022227430.2"
                     /db_xref="GeneID:111077456"
                     /translation="MANKSVPVKKVLSPLQPAITSDMVNKLQQTPASEAKISGSVASA
                     WRSPQLMIVFEDGDLHSARQHLLDSLQNPFAEGAVATVLLQESVRDQFVGLVAQNLKR
                     LEPQVAGHPSYVRTLAQIELLKANVIKAEGDVPADASPLLVSDFVSSYLGQPGPTGAI
                     TLQTFRTAREATLVNLKESVPYARVSIWNEKLACAYEVLGHLAVDTFTINCFNPDLSP
                     IRSAFEANQNDVCLFKGYHYETLTVNFKRRIVVFPVGTMFAN"
     misc_feature    208..852
                     /gene="LOC111077456"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:448367"
ORIGIN      
        1 gagctgctga taacgcgatc agacgacgcc ttgatacggt ttcaatttct ttgtgaaaat
       61 cggtgaacag agcaaggaat ggccaacaag tccgtgccgg tgaaaaaagt actcagccca
      121 ctccagccag cgatcaccag cgacatggtc aacaagctgc agcagacgcc ggcgtccgag
      181 gcgaagattt cgggaagcgt ggcttctgcg tggcggtccc cccagctgat gatcgtgttc
      241 gaggacggcg atctgcactc ggcccggcag cacctgctcg actcgctgca aaacccgttc
      301 gcggagggag ccgtggccac ggtgctgctg caggaaagcg ttcgggatca gtttgtgggc
      361 ctggtggccc agaacctcaa gcgactggag ccacaggtgg ccggacatcc cagctacgtg
      421 cgcaccctgg cccagatcga gctgctcaag gccaatgtga tcaaagctga gggagatgtc
      481 ccagccgatg catcgcccct gctggtgtct gactttgtaa gcagctatct ggggcagccg
      541 ggccccactg gcgccattac cctgcaaacc ttccgcactg cgcgcgaggc cacgctggtg
      601 aatttgaagg agtcggtgcc ctacgccagg gtcagcatct ggaacgagaa gctggcctgt
      661 gcatacgaag tgctcggcca cctggccgtc gacaccttca cgatcaactg cttcaacccg
      721 gacctaagtc ccatccgatc ggcgttcgag gccaatcaaa acgatgtttg cctgttcaag
      781 ggctatcact acgagacgct gacagtgaac tttaagcgcc ggatcgtcgt cttcccggtg
      841 ggaaccatgt tcgccaacta attttgatct ggagttggaa ttggactggg attcctattc
      901 aacaaggtgc ttgatcaatc atgccataca tatttacccc ttttgtaact gttttttgta
      961 cttataattg ttcaatacac gcgttgcatg acccaaccga