Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura multiple inositol polyphosphate


LOCUS       XM_022371732             648 bp    mRNA    linear   INV 14-MAY-2021
            phosphatase 1 (LOC121403783), mRNA.
ACCESSION   XM_022371732
VERSION     XM_022371732.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371732.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..648
                     /gene="LOC121403783"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:121403783"
     CDS             1..648
                     /gene="LOC121403783"
                     /codon_start=1
                     /product="multiple inositol polyphosphate phosphatase 1"
                     /protein_id="XP_022227424.2"
                     /db_xref="GeneID:121403783"
                     /translation="MQSAVEHVRGSTQLPDLQAEDVELMYMVCAFETSWQRRRQRESV
                     WCSFFDVDSLKALEFAKDLEYYWNDGYGYELTHRIACPAIADMFAAIDPISQASMRAN
                     ATFYFTHSGTLLKLLAHLGLAKDKEALTHKHFGSERLWRTSEIDAFATNLAFLRYECE
                     QEPPRVLVMHQERVVRLPGCPQNEDLCSLATLRRLYADNVERCDFEALCQPDDTK"
     misc_feature    <58..531
                     /gene="LOC121403783"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:472174"
ORIGIN      
        1 atgcagtcag cagtggagca tgtgcggggc agcactcagt tgccggatct gcaggccgag
       61 gatgtggagc tcatgtatat ggtgtgtgcg ttcgagacat cctggcagcg tcggaggcag
      121 cgcgagtccg tctggtgcag cttctttgat gtggatagct tgaaggcttt ggagtttgcc
      181 aaggatctgg agtactattg gaacgatggc tatggctatg agctgaccca tcgcattgcc
      241 tgtccggcga tagcagatat gtttgcagcc atcgacccaa tctcccaggc ctccatgcgt
      301 gccaatgcca cgttctactt cactcactcg ggcacactgc tgaagctact ggcccatctc
      361 ggtctggcca aggacaagga ggcactcacc cacaagcatt ttggcagcga gcgtctctgg
      421 cgcaccagtg aaatcgatgc ctttgcgacc aacttggcat ttttgcgcta cgaatgcgag
      481 caggagccgc cccgtgtttt ggtgatgcac caggagcgtg tcgtccgcct gcctggttgc
      541 ccccaaaacg aggatctgtg ctcgcttgcc acgctacgcc gcctatatgc ggacaacgtg
      601 gaacgctgcg actttgaggc cctctgccag cccgacgata cgaaatga