Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022371726 1141 bp mRNA linear INV 14-MAY-2021 (LOC111077448), mRNA. ACCESSION XM_022371726 VERSION XM_022371726.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022371726.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1141 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1141 /gene="LOC111077448" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:111077448" CDS 159..716 /gene="LOC111077448" /codon_start=1 /product="uncharacterized protein LOC111077448" /protein_id="XP_022227418.1" /db_xref="GeneID:111077448" /translation="MMTTMMMRLPLQLLIMLLLLRHCTRGTPIAPTTKDGATPIDARV TAEEFGALDAFAEAESTQVAASEATAGFKLSLLPKPAQTAESVNLEQEAIPSKVLSAY ENSHKRVAELSQPVPILDTISEHEKYGNNGDMFDGISRTIVNGYEAFSNLLNTLIQKP RELARSVSKGITTQLDIIGGKLVGL" ORIGIN 1 cgcagacgcg gcgattcagt tgaaatttgg acttggccgc gcacagacag cgactggcca 61 aaagcggaga cagcccgaaa gttagcgacg ttttcacttc acttcagttt acttcacttt 121 cggtttcgta agagtccaca ccactggttg gtttcgcaat gatgacgaca atgatgatga 181 ggcttccgct gcaactgctg ataatgctgc tgctgctccg ccactgcact cgcggcacac 241 ccatagcgcc cacaaccaaa gacggtgcca cgcccatcga tgccagggta acggccgaag 301 agtttggagc cctcgatgca tttgccgagg cggagtccac acaggtagcg gccagtgagg 361 cgacggccgg tttcaagctc tcgctgctgc ccaagcccgc ccagacggcg gagtcggtga 421 acctcgaaca ggaggccata ccctccaagg tgctcagcgc ctacgaaaac agccacaaga 481 gggtggccga gctgtcccag cccgttccca ttttggatac catcagtgag cacgagaagt 541 acggcaacaa tggcgacatg ttcgacggca tctcacggac cattgtcaat ggttacgagg 601 ccttttccaa tctgctcaac accttgatac agaaacccag agagctggct cgcagcgtct 661 ccaagggcat caccactcag ctggacatca tcgggggcaa gctggtgggc ctctgaagag 721 aatgcctttg gccgagcttt caccgaggga gttacatggc tcgtcatggc aatgaccgtt 781 gaagagggtg ttacagatgt ttcccagcgg ctggactttc ataaattaca tgtaaatcta 841 atcggaatgc acagcctatt cgatatagcc gatatgtccg tcagtccgtc tagatgaaag 901 ttttgcttcc ggcagtatac ttcaagtcgg agctgccata catatatgta tatcggatgg 961 ccatatcgtt tagttgtcat gggaattatt ggtcgtgtgt gtgggagcac tgcttacaat 1021 atgtactctt atataaatca atttgtatgt atgcctatct ttttaaatgt taaatgtttt 1081 ttgtttttgt ttgtttttgt tttgtatgta atttaaataa atactttaat ttatttgtaa 1141 c