Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111077448


LOCUS       XM_022371726            1141 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111077448), mRNA.
ACCESSION   XM_022371726
VERSION     XM_022371726.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371726.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1141
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1141
                     /gene="LOC111077448"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 14 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111077448"
     CDS             159..716
                     /gene="LOC111077448"
                     /codon_start=1
                     /product="uncharacterized protein LOC111077448"
                     /protein_id="XP_022227418.1"
                     /db_xref="GeneID:111077448"
                     /translation="MMTTMMMRLPLQLLIMLLLLRHCTRGTPIAPTTKDGATPIDARV
                     TAEEFGALDAFAEAESTQVAASEATAGFKLSLLPKPAQTAESVNLEQEAIPSKVLSAY
                     ENSHKRVAELSQPVPILDTISEHEKYGNNGDMFDGISRTIVNGYEAFSNLLNTLIQKP
                     RELARSVSKGITTQLDIIGGKLVGL"
ORIGIN      
        1 cgcagacgcg gcgattcagt tgaaatttgg acttggccgc gcacagacag cgactggcca
       61 aaagcggaga cagcccgaaa gttagcgacg ttttcacttc acttcagttt acttcacttt
      121 cggtttcgta agagtccaca ccactggttg gtttcgcaat gatgacgaca atgatgatga
      181 ggcttccgct gcaactgctg ataatgctgc tgctgctccg ccactgcact cgcggcacac
      241 ccatagcgcc cacaaccaaa gacggtgcca cgcccatcga tgccagggta acggccgaag
      301 agtttggagc cctcgatgca tttgccgagg cggagtccac acaggtagcg gccagtgagg
      361 cgacggccgg tttcaagctc tcgctgctgc ccaagcccgc ccagacggcg gagtcggtga
      421 acctcgaaca ggaggccata ccctccaagg tgctcagcgc ctacgaaaac agccacaaga
      481 gggtggccga gctgtcccag cccgttccca ttttggatac catcagtgag cacgagaagt
      541 acggcaacaa tggcgacatg ttcgacggca tctcacggac cattgtcaat ggttacgagg
      601 ccttttccaa tctgctcaac accttgatac agaaacccag agagctggct cgcagcgtct
      661 ccaagggcat caccactcag ctggacatca tcgggggcaa gctggtgggc ctctgaagag
      721 aatgcctttg gccgagcttt caccgaggga gttacatggc tcgtcatggc aatgaccgtt
      781 gaagagggtg ttacagatgt ttcccagcgg ctggactttc ataaattaca tgtaaatcta
      841 atcggaatgc acagcctatt cgatatagcc gatatgtccg tcagtccgtc tagatgaaag
      901 ttttgcttcc ggcagtatac ttcaagtcgg agctgccata catatatgta tatcggatgg
      961 ccatatcgtt tagttgtcat gggaattatt ggtcgtgtgt gtgggagcac tgcttacaat
     1021 atgtactctt atataaatca atttgtatgt atgcctatct ttttaaatgt taaatgtttt
     1081 ttgtttttgt ttgtttttgt tttgtatgta atttaaataa atactttaat ttatttgtaa
     1141 c