Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura tetraspanin-9 (LOC111077447), mRNA.


LOCUS       XM_022371725            1264 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022371725
VERSION     XM_022371725.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371725.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1264
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1264
                     /gene="LOC111077447"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 15 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111077447"
     CDS             385..1236
                     /gene="LOC111077447"
                     /codon_start=1
                     /product="tetraspanin-9"
                     /protein_id="XP_022227417.1"
                     /db_xref="GeneID:111077447"
                     /translation="MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYEGYATL
                     LPQHAALSADMIFMSIGGTGFVVSFLGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGS
                     IAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVAAIWDSVQQSFECCGVSSYE
                     DWYDIQSWTGKRWVPESCCRTLYDQRQLMTEGSGDGLLRVDCGRSENPSLWWDKGCAH
                     SLQSWFTGQLNVVGAIGLGIAFVQLFGLITSMLLFCTVKHKRASDTYKSYSPSIDPQT
                     RTSSWED"
     misc_feature    409..1146
                     /gene="LOC111077447"
                     /note="Tetraspanin family; Region: Tetraspanin; pfam00335"
                     /db_xref="CDD:459767"
     misc_feature    697..1068
                     /gene="LOC111077447"
                     /note="Tetraspanin, extracellular domain or large
                     extracellular loop (LEL), NET-5_like family. Tetraspanins
                     are trans-membrane proteins with 4 trans-membrane
                     segments. Both the N- and C-termini lie on the
                     intracellular side of the membrane. This alignment
                     model...; Region: NET-5_like_LEL; cd03165"
                     /db_xref="CDD:239418"
     misc_feature    order(700..702,715..717,727..729,733..738,745..747,
                     811..813,820..825,832..837)
                     /gene="LOC111077447"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239418"
ORIGIN      
        1 ttttgtcgtc aagtttattt cagcaaccgc cgcgagcgca tcatagaacc tgcggaccga
       61 gccgagcagc agtgccgtgc tgaacagcag cagcagcagc aaaagcgcaa aatagaaaac
      121 tctcaaaaat tgaaattgtt gtaaaaataa attggacaaa aacgtgtgtc ggcgaagaat
      181 aaccgaaaag gagatcaaac aaattctaaa aaatatatat aacaaaaaca acgatcacat
      241 caaattgcaa cacaattttt ttttgcagtt aaattttgtg tttattagtg cgcgacatca
      301 atacggacga ccgatcgaaa ctaaaaccga taccgaaatc gaaaccgatt ctcccttcag
      361 ttggagtaaa acaaatctcc cgcgatgggt aacgccggct acacgtgcat acgccgcacc
      421 ttttgctggc tgaacatcat tctatggctc tgcagctgcg ctttcctggg cgccggcctt
      481 tggctgcgcc tcagctacga gggatatgcg acactgctgc cgcaacatgc cgctctcagt
      541 gcggatatga tcttcatgtc gattgggggt actgggttcg tggtgagctt ccttggctgc
      601 tgcggcgcct gggtacagtc gcgctgtttg ctggtgctgt actttatgct gatcgtgatg
      661 ctgttcatga gcgagttcct ggtgggctcc attgcgttcc tcttccgcgg cggcctggga
      721 cggacgctgg ccaacgagct gcgcttcgga atcgagcgcc actacaacag cagtgaccgc
      781 ggctccctgg tggccccgtc ggtggccgcc atttgggata gtgtgcagca gtcgtttgag
      841 tgctgcggtg tatcctcgta cgaggactgg tacgacatcc aatcgtggac gggcaagcgc
      901 tgggtgccag agtcctgctg ccgcactctg tacgaccaac gccaactgat gaccgaagga
      961 tccggcgatg gtctcctgcg cgtcgactgc ggcagatcag agaacccctc gctgtggtgg
     1021 gacaagggat gcgcccattc gctccagagc tggttcaccg gccagctgaa tgtggtgggt
     1081 gccattggac tgggcatcgc cttcgtgcag ctcttcggac tgatcacctc gatgctgctc
     1141 ttctgcaccg tcaagcataa gcgagcctcc gacacataca aatcctactc gccctcgatc
     1201 gacccccaga cccgcaccag cagttgggag gattgaaccc gtctgtagca gagggacaac
     1261 atct