Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022371721 1524 bp mRNA linear INV 14-MAY-2021 (LOC111077443), transcript variant X2, mRNA. ACCESSION XM_022371721 VERSION XM_022371721.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022371721.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1524 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1524 /gene="LOC111077443" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:111077443" CDS 353..1291 /gene="LOC111077443" /codon_start=1 /product="uncharacterized protein LOC111077443" /protein_id="XP_022227413.1" /db_xref="GeneID:111077443" /translation="MPYNLWLRRRLQLLASMLLCALLGYLTSSSAKPTLSFSLPQGLQ GFPSFQSFTQQILEQRSVRQMKTYSGKRLSNDSLIMIYYHDLTIAVTELGPQKLLLGC ELIEIYNDKEGKMLLDGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKVKSEGG DERSSGGAGGGASGDTALASGIDGLKLSTNIFPRSPFSLLSGIIPGTKWCGTGDIAET YSDLGSEMAMDRCCRQHDLCPVKIRAYQPKYDLMNDSIYTKSHCICDDMLFSCLKKTN TSASQLMGSIYFNLVQVPCLEGRSNQYKFRKAKEGF" misc_feature 959..1243 /gene="LOC111077443" /note="A sub-family of Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of...; Region: PLA2_bee_venom_like; cd04704" /db_xref="CDD:153093" misc_feature order(977..979,983..985,989..991,1058..1060) /gene="LOC111077443" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:153093" misc_feature order(1055..1057,1145..1147,1211..1213) /gene="LOC111077443" /note="catalytic site [active]" /db_xref="CDD:153093" ORIGIN 1 tggtgtctct tgatcgatca gttgctgact ttgcgcggca gcgaacggta ttgcgttttc 61 aatagttatt ccggcttcca ttaccgttac tgcaaccagc gattgcgatt tcgattgcta 121 cagccactgc gcatgcgcgc cggactccga atcggtttcg gttccgccgg gaaggcgaag 181 gtacaccacc gtacaccgta caccgtacac cggctatcgt aattgccatc gccggagcga 241 gcgaccacac cagacccgac cagactgtaa tgtgactttg ggtctggccc acgtgaacca 301 gttgcctctc cagtttccac acacatccac gttcgtccag cttcgatccg ggatgcccta 361 caatctgtgg ctgcgtcggc gactccagtt gctggcctcg atgctgcttt gcgccctgct 421 cggctatctt acctcatcgt cggccaagcc gacgctgtcg ttcagcctgc cgcagggact 481 gcagggcttt ccatcgtttc aatcgttcac ccagcaaatc ctcgagcagc ggagcgtgcg 541 acaaatgaag acgtacagcg ggaagcggct gagcaatgac tcgctcatta tgatatacta 601 tcacgatctg accatagccg taacggagct gggcccacag aagctgctgt tgggctgcga 661 actgatcgaa atctacaacg acaaggaggg aaagatgctg ctggatggac tctcccacta 721 caatcgtccg ctggagatca agttcgatga gatgctcaag ctgatggacc aatgcgagca 781 cgtggacaag ctgagctacg cctcgcgtca caaggtcaaa tcggagggtg gtgatgaaag 841 gagcagcggt ggtgctggtg gtggtgccag cggtgataca gccctagcca gtggcatcga 901 tggcctcaag ctgtccacca acatctttcc gcgcagtccc ttttccctgc tcagcggcat 961 tataccaggc accaagtggt gcggcactgg cgacattgcg gagacgtaca gcgatctggg 1021 cagcgagatg gccatggatc ggtgctgtcg ccagcacgat ctctgcccgg tgaagatccg 1081 tgcctaccag cccaagtacg acctgatgaa tgactccatc tacaccaagt cgcactgcat 1141 ctgcgatgat atgctgttca gctgcctgaa gaagaccaac acctcggcca gccagctgat 1201 gggctccatc tatttcaatc tggtgcaggt gccctgtctg gaggggcgca gcaatcaata 1261 caagttccgg aaggccaagg agggtttcta agcgaaacat atatacagac atacatacaa 1321 atagtataca taagtggggg acattggggg ctgtgggtgc gctggggttt cactgtacag 1381 gatggcagag acggactatt tattggttga ttggcaaacg atgaggccca cttttattac 1441 tgttattgat tattctgtta ggcaatacag ataaacataa gtagagttgc aattcattat 1501 cctttataca tgcaaataat aata