Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111077443


LOCUS       XM_022371720            1561 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111077443), transcript variant X1, mRNA.
ACCESSION   XM_022371720
VERSION     XM_022371720.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371720.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1561
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1561
                     /gene="LOC111077443"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 15 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 13 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111077443"
     CDS             390..1328
                     /gene="LOC111077443"
                     /codon_start=1
                     /product="uncharacterized protein LOC111077443"
                     /protein_id="XP_022227412.1"
                     /db_xref="GeneID:111077443"
                     /translation="MPYNLWLRRRLQLLASMLLCALLGYLTSSSAKPTLSFSLPQGLQ
                     GFPSFQSFTQQILEQRSVRQMKTYSGKRLSNDSLIMIYYHDLTIAVTELGPQKLLLGC
                     ELIEIYNDKEGKMLLDGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKVKSEGG
                     DERSSGGAGGGASGDTALASGIDGLKLSTNIFPRSPFSLLSGIIPGTKWCGTGDIAET
                     YSDLGSEMAMDRCCRQHDLCPVKIRAYQPKYDLMNDSIYTKSHCICDDMLFSCLKKTN
                     TSASQLMGSIYFNLVQVPCLEGRSNQYKFRKAKEGF"
     misc_feature    996..1280
                     /gene="LOC111077443"
                     /note="A sub-family of Phospholipase A2, similar to bee
                     venom PLA2. PLA2 is a super-family of secretory and
                     cytosolic enzymes; the latter are either Ca dependent or
                     Ca independent. Enzymatically active PLA2 cleaves the sn-2
                     position of the glycerol backbone of...; Region:
                     PLA2_bee_venom_like; cd04704"
                     /db_xref="CDD:153093"
     misc_feature    order(1014..1016,1020..1022,1026..1028,1095..1097)
                     /gene="LOC111077443"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153093"
     misc_feature    order(1092..1094,1182..1184,1248..1250)
                     /gene="LOC111077443"
                     /note="catalytic site [active]"
                     /db_xref="CDD:153093"
ORIGIN      
        1 tggtgtctct tgatcgatca gttgctgact ttgcgcggca gcgaacggta ttgcgttttc
       61 aatagttatt ccggcttcca ttaccgttac tgcaaccagc gattgcgatt tcgattgcta
      121 cagccactgc gcatgcgcgc cggactccga atcggtgggg gaaaaacagc gtctattttt
      181 tatttttttt ggtttcggtt ccgccgggaa ggcgaaggta caccaccgta caccgtacac
      241 cgtacaccgg ctatcgtaat tgccatcgcc ggagcgagcg accacaccag acccgaccag
      301 actgtaatgt gactttgggt ctggcccacg tgaaccagtt gcctctccag tttccacaca
      361 catccacgtt cgtccagctt cgatccggga tgccctacaa tctgtggctg cgtcggcgac
      421 tccagttgct ggcctcgatg ctgctttgcg ccctgctcgg ctatcttacc tcatcgtcgg
      481 ccaagccgac gctgtcgttc agcctgccgc agggactgca gggctttcca tcgtttcaat
      541 cgttcaccca gcaaatcctc gagcagcgga gcgtgcgaca aatgaagacg tacagcggga
      601 agcggctgag caatgactcg ctcattatga tatactatca cgatctgacc atagccgtaa
      661 cggagctggg cccacagaag ctgctgttgg gctgcgaact gatcgaaatc tacaacgaca
      721 aggagggaaa gatgctgctg gatggactct cccactacaa tcgtccgctg gagatcaagt
      781 tcgatgagat gctcaagctg atggaccaat gcgagcacgt ggacaagctg agctacgcct
      841 cgcgtcacaa ggtcaaatcg gagggtggtg atgaaaggag cagcggtggt gctggtggtg
      901 gtgccagcgg tgatacagcc ctagccagtg gcatcgatgg cctcaagctg tccaccaaca
      961 tctttccgcg cagtcccttt tccctgctca gcggcattat accaggcacc aagtggtgcg
     1021 gcactggcga cattgcggag acgtacagcg atctgggcag cgagatggcc atggatcggt
     1081 gctgtcgcca gcacgatctc tgcccggtga agatccgtgc ctaccagccc aagtacgacc
     1141 tgatgaatga ctccatctac accaagtcgc actgcatctg cgatgatatg ctgttcagct
     1201 gcctgaagaa gaccaacacc tcggccagcc agctgatggg ctccatctat ttcaatctgg
     1261 tgcaggtgcc ctgtctggag gggcgcagca atcaatacaa gttccggaag gccaaggagg
     1321 gtttctaagc gaaacatata tacagacata catacaaata gtatacataa gtgggggaca
     1381 ttgggggctg tgggtgcgct ggggtttcac tgtacaggat ggcagagacg gactatttat
     1441 tggttgattg gcaaacgatg aggcccactt ttattactgt tattgattat tctgttaggc
     1501 aatacagata aacataagta gagttgcaat tcattatcct ttatacatgc aaataataat
     1561 a