Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022371720 1561 bp mRNA linear INV 14-MAY-2021 (LOC111077443), transcript variant X1, mRNA. ACCESSION XM_022371720 VERSION XM_022371720.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022371720.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1561 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1561 /gene="LOC111077443" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns" /db_xref="GeneID:111077443" CDS 390..1328 /gene="LOC111077443" /codon_start=1 /product="uncharacterized protein LOC111077443" /protein_id="XP_022227412.1" /db_xref="GeneID:111077443" /translation="MPYNLWLRRRLQLLASMLLCALLGYLTSSSAKPTLSFSLPQGLQ GFPSFQSFTQQILEQRSVRQMKTYSGKRLSNDSLIMIYYHDLTIAVTELGPQKLLLGC ELIEIYNDKEGKMLLDGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKVKSEGG DERSSGGAGGGASGDTALASGIDGLKLSTNIFPRSPFSLLSGIIPGTKWCGTGDIAET YSDLGSEMAMDRCCRQHDLCPVKIRAYQPKYDLMNDSIYTKSHCICDDMLFSCLKKTN TSASQLMGSIYFNLVQVPCLEGRSNQYKFRKAKEGF" misc_feature 996..1280 /gene="LOC111077443" /note="A sub-family of Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of...; Region: PLA2_bee_venom_like; cd04704" /db_xref="CDD:153093" misc_feature order(1014..1016,1020..1022,1026..1028,1095..1097) /gene="LOC111077443" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:153093" misc_feature order(1092..1094,1182..1184,1248..1250) /gene="LOC111077443" /note="catalytic site [active]" /db_xref="CDD:153093" ORIGIN 1 tggtgtctct tgatcgatca gttgctgact ttgcgcggca gcgaacggta ttgcgttttc 61 aatagttatt ccggcttcca ttaccgttac tgcaaccagc gattgcgatt tcgattgcta 121 cagccactgc gcatgcgcgc cggactccga atcggtgggg gaaaaacagc gtctattttt 181 tatttttttt ggtttcggtt ccgccgggaa ggcgaaggta caccaccgta caccgtacac 241 cgtacaccgg ctatcgtaat tgccatcgcc ggagcgagcg accacaccag acccgaccag 301 actgtaatgt gactttgggt ctggcccacg tgaaccagtt gcctctccag tttccacaca 361 catccacgtt cgtccagctt cgatccggga tgccctacaa tctgtggctg cgtcggcgac 421 tccagttgct ggcctcgatg ctgctttgcg ccctgctcgg ctatcttacc tcatcgtcgg 481 ccaagccgac gctgtcgttc agcctgccgc agggactgca gggctttcca tcgtttcaat 541 cgttcaccca gcaaatcctc gagcagcgga gcgtgcgaca aatgaagacg tacagcggga 601 agcggctgag caatgactcg ctcattatga tatactatca cgatctgacc atagccgtaa 661 cggagctggg cccacagaag ctgctgttgg gctgcgaact gatcgaaatc tacaacgaca 721 aggagggaaa gatgctgctg gatggactct cccactacaa tcgtccgctg gagatcaagt 781 tcgatgagat gctcaagctg atggaccaat gcgagcacgt ggacaagctg agctacgcct 841 cgcgtcacaa ggtcaaatcg gagggtggtg atgaaaggag cagcggtggt gctggtggtg 901 gtgccagcgg tgatacagcc ctagccagtg gcatcgatgg cctcaagctg tccaccaaca 961 tctttccgcg cagtcccttt tccctgctca gcggcattat accaggcacc aagtggtgcg 1021 gcactggcga cattgcggag acgtacagcg atctgggcag cgagatggcc atggatcggt 1081 gctgtcgcca gcacgatctc tgcccggtga agatccgtgc ctaccagccc aagtacgacc 1141 tgatgaatga ctccatctac accaagtcgc actgcatctg cgatgatatg ctgttcagct 1201 gcctgaagaa gaccaacacc tcggccagcc agctgatggg ctccatctat ttcaatctgg 1261 tgcaggtgcc ctgtctggag gggcgcagca atcaatacaa gttccggaag gccaaggagg 1321 gtttctaagc gaaacatata tacagacata catacaaata gtatacataa gtgggggaca 1381 ttgggggctg tgggtgcgct ggggtttcac tgtacaggat ggcagagacg gactatttat 1441 tggttgattg gcaaacgatg aggcccactt ttattactgt tattgattat tctgttaggc 1501 aatacagata aacataagta gagttgcaat tcattatcct ttatacatgc aaataataat 1561 a