Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura malignant T-cell-amplified sequence 1


LOCUS       XM_022371710             849 bp    mRNA    linear   INV 14-MAY-2021
            homolog (LOC111077435), mRNA.
ACCESSION   XM_022371710
VERSION     XM_022371710.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022371710.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..849
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..849
                     /gene="LOC111077435"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111077435"
     CDS             90..638
                     /gene="LOC111077435"
                     /codon_start=1
                     /product="malignant T-cell-amplified sequence 1 homolog"
                     /protein_id="XP_022227402.1"
                     /db_xref="GeneID:111077435"
                     /translation="MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLETHIDLIL
                     PKKDSYRIAKCHDHIELLLNGAGEQVFFRHRDGPWMPTLRLLHKFPYFVTMEQVDKGA
                     IRFVLSGANVMCPGLTSPGACMTPAEKNTVVAIMAEGKEHALAIGLLTLSTEEILAKN
                     KGIGIETYHFLNDGLWKSKPVK"
     misc_feature    99..332
                     /gene="LOC111077435"
                     /note="N-terminal domain of multiple copies T cell
                     malignancies 1 and related proteins; Region: MCT1_N;
                     cd11609"
                     /db_xref="CDD:211422"
     misc_feature    order(183..188,303..305,309..311,321..332)
                     /gene="LOC111077435"
                     /note="PUA domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:211422"
     misc_feature    330..617
                     /gene="LOC111077435"
                     /note="PUA RNA-binding domain of malignant T
                     cell-amplified sequence 1 and related proteins; Region:
                     PUA_MCTS-1-like; cd21155"
                     /db_xref="CDD:409297"
     misc_feature    order(384..386,402..404,408..416,420..428,573..578,
                     588..599)
                     /gene="LOC111077435"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:409297"
ORIGIN      
        1 ccatcgatag tagaggctag cagcaaaata tcgataccat cgattgtgcc ctctttggtt
       61 tgacacctgg tctaacaaat tttagcaaaa tgttcaaaaa attcgaggag aaggacagta
      121 tctcgtccat acagcagctc aaatcgtccg tacagaaggg catacgtgcc aagctgcttg
      181 aggcatatcc caagctggag acacacattg atctgatatt gcccaagaag gactcgtatc
      241 gcattgccaa gtgccatgac cacatcgagc tgctgctaaa cggggccggc gagcaagtat
      301 tctttcggca ccgcgatggc ccttggatgc cgacgctgcg ccttctccac aagtttccct
      361 actttgtcac catggagcag gtggacaagg gtgccatccg ctttgttttg agtggcgcga
      421 atgtcatgtg cccagggctg acgtcgccgg gtgcctgcat gacgccggct gagaagaaca
      481 cggtggtggc catcatggcc gagggcaaag agcacgcgct ggccatcggt ctgctcacac
      541 tctccactga agaaattttg gccaagaaca aaggcatcgg cattgagacg taccatttcc
      601 tcaacgacgg cctttggaag tcgaaaccag tcaagtaaga ccgaaaatca ggacaggacc
      661 cggaccggac ccctgcacac gcgcgcacac acgccatgcg gtcgttgctt ttattctgag
      721 agcaaagaat ggtttttatt tcgtttgata tgcaaactga atcctgatca taattaattt
      781 ttttttattt tcttaatttt aaactgtcag tcaaactatt taagccgatg cgaaatataa
      841 ttaatggca