Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022371710 849 bp mRNA linear INV 14-MAY-2021 homolog (LOC111077435), mRNA. ACCESSION XM_022371710 VERSION XM_022371710.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022371710.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..849 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..849 /gene="LOC111077435" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111077435" CDS 90..638 /gene="LOC111077435" /codon_start=1 /product="malignant T-cell-amplified sequence 1 homolog" /protein_id="XP_022227402.1" /db_xref="GeneID:111077435" /translation="MFKKFEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLETHIDLIL PKKDSYRIAKCHDHIELLLNGAGEQVFFRHRDGPWMPTLRLLHKFPYFVTMEQVDKGA IRFVLSGANVMCPGLTSPGACMTPAEKNTVVAIMAEGKEHALAIGLLTLSTEEILAKN KGIGIETYHFLNDGLWKSKPVK" misc_feature 99..332 /gene="LOC111077435" /note="N-terminal domain of multiple copies T cell malignancies 1 and related proteins; Region: MCT1_N; cd11609" /db_xref="CDD:211422" misc_feature order(183..188,303..305,309..311,321..332) /gene="LOC111077435" /note="PUA domain interface [polypeptide binding]; other site" /db_xref="CDD:211422" misc_feature 330..617 /gene="LOC111077435" /note="PUA RNA-binding domain of malignant T cell-amplified sequence 1 and related proteins; Region: PUA_MCTS-1-like; cd21155" /db_xref="CDD:409297" misc_feature order(384..386,402..404,408..416,420..428,573..578, 588..599) /gene="LOC111077435" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:409297" ORIGIN 1 ccatcgatag tagaggctag cagcaaaata tcgataccat cgattgtgcc ctctttggtt 61 tgacacctgg tctaacaaat tttagcaaaa tgttcaaaaa attcgaggag aaggacagta 121 tctcgtccat acagcagctc aaatcgtccg tacagaaggg catacgtgcc aagctgcttg 181 aggcatatcc caagctggag acacacattg atctgatatt gcccaagaag gactcgtatc 241 gcattgccaa gtgccatgac cacatcgagc tgctgctaaa cggggccggc gagcaagtat 301 tctttcggca ccgcgatggc ccttggatgc cgacgctgcg ccttctccac aagtttccct 361 actttgtcac catggagcag gtggacaagg gtgccatccg ctttgttttg agtggcgcga 421 atgtcatgtg cccagggctg acgtcgccgg gtgcctgcat gacgccggct gagaagaaca 481 cggtggtggc catcatggcc gagggcaaag agcacgcgct ggccatcggt ctgctcacac 541 tctccactga agaaattttg gccaagaaca aaggcatcgg cattgagacg taccatttcc 601 tcaacgacgg cctttggaag tcgaaaccag tcaagtaaga ccgaaaatca ggacaggacc 661 cggaccggac ccctgcacac gcgcgcacac acgccatgcg gtcgttgctt ttattctgag 721 agcaaagaat ggtttttatt tcgtttgata tgcaaactga atcctgatca taattaattt 781 ttttttattt tcttaatttt aaactgtcag tcaaactatt taagccgatg cgaaatataa 841 ttaatggca