Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111076904


LOCUS       XM_022370955             711 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111076904), mRNA.
ACCESSION   XM_022370955
VERSION     XM_022370955.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022370955.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 56% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..711
                     /gene="LOC111076904"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 19% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111076904"
     CDS             1..711
                     /gene="LOC111076904"
                     /codon_start=1
                     /product="uncharacterized protein LOC111076904"
                     /protein_id="XP_022226647.2"
                     /db_xref="GeneID:111076904"
                     /translation="MDQNSGAVPKKLHTVPELSAEHVSANDSAENVPGNGSDFHNEPM
                     SFHRDQIDITELRSYCIQHEMPLPIIEIVQQCGTPHAPEYVACCTVASIKRYGRKDAR
                     QRAAIEMLTVISADEGPLPGDAPNHDLEVERRGPRTGGRKPCDAHNYYREFLPHLKAA
                     AFEVDSIDSKDYKNEKEQLLALLSALKITPKFSTVPSTSGVTLVKVQLNVDFDKLFID
                     FESKICGYMINYFKVMLN"
     misc_feature    175..330
                     /gene="LOC111076904"
                     /note="double-stranded RNA binding motif (DSRM)
                     superfamily; Region: DSRM_SF; cd00048"
                     /db_xref="CDD:380679"
ORIGIN      
        1 atggatcaaa attctggtgc cgttccgaag aagctgcaca cagtgccgga gctcagtgcc
       61 gagcatgtgt cggccaacga ttccgctgaa aatgtccctg gcaacggctc agactttcac
      121 aatgagccaa tgagcttcca tcgtgatcag atcgacatca cagagctgcg cagctactgc
      181 attcagcatg agatgccgct gcccatcatc gagattgtgc agcagtgcgg caccccacac
      241 gcacctgaat acgtggcctg ctgcacggtg gcctccatca agcgctacgg caggaaggat
      301 gcccgccagc gggccgccat cgagatgctg accgtcatct cagccgacga gggtcctctt
      361 cctggcgatg ccccgaatca cgacttggag gtcgaacgtc gtggcccaag gactgggggc
      421 cgtaagccgt gcgatgccca caactactat agggagttct tgccgcacct gaaggcggcc
      481 gccttcgagg tcgattccat cgattccaag gactacaaga acgaaaagga gcagctgctg
      541 gccctactga gtgccctcaa gatcacaccc aaattctcca ctgttccatc gacatccggg
      601 gtgacccttg tgaaggtgca gctaaatgtg gatttcgata aactttttat tgatttcgaa
      661 agcaagatct gtggctatat gattaactac tttaaggtta tgctcaacta g