Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura NADH dehydrogenase [ubiquinone] 1


LOCUS       XM_022370954             736 bp    mRNA    linear   INV 14-MAY-2021
            alpha subcomplex subunit 13 (LOC111076903), transcript variant X2,
            mRNA.
ACCESSION   XM_022370954
VERSION     XM_022370954.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022370954.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..736
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..736
                     /gene="LOC111076903"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111076903"
     CDS             117..581
                     /gene="LOC111076903"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit 13"
                     /protein_id="XP_022226646.1"
                     /db_xref="GeneID:111076903"
                     /translation="MAPAVPQVPPKQDLPPAGGYKKIPFARVLPKSYFTGFTMIGTYV
                     AVTTVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILIAERDREFLRQLRRNRDEEAELM
                     KNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAHADWKSYAKRAHIKLWS"
     misc_feature    141..536
                     /gene="LOC111076903"
                     /note="GRIM-19 protein; Region: GRIM-19; pfam06212"
                     /db_xref="CDD:461852"
ORIGIN      
        1 tagtcgatag ggccatcggt tgtgggccag ccctagtgtt atgcaaaacg cttcttgaca
       61 tttttgacgg ccgatttcct attttttcaa tacaattttt atagccagca gtcaccatgg
      121 ccccggccgt gccacaagtg ccccctaagc aggacctgcc tccagccggt ggctacaaga
      181 agattccctt tgctcgtgtg cttcccaaga gctatttcac aggcttcacc atgattggca
      241 cctatgtggc cgtcaccacc gtcggtctag gaatctacta tctgacggcc aagaaggtta
      301 aacgcgacga gatcgagatg cgttcggccc agaatgtcat ctttccgatc ctgattgccg
      361 agcgcgatcg tgagttcctg cgccagttgc gtcgcaaccg ggacgaggag gccgagctaa
      421 tgaagaatgt gcccggctgg gaggtgggca cctggtacgg tgagcccgtc ttcaagaccc
      481 tgcccgagga cactctggta acgcccatct tcaaggagtt ctatgcccat gccgactgga
      541 agtcgtacgc caagcgtgcc cacatcaagc tctggtcgta agccaacggg aagaacggag
      601 ccgcagcagc gtactgctac ttagttaatg catattgtga agcttttttg tttatagaat
      661 tgcctaagcg cgcctgctca ttgcactcaa ttacatgtcg agagattgat tgaaatgggg
      721 aaaaaaacga aacgaa