Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022370953 735 bp mRNA linear INV 14-MAY-2021 alpha subcomplex subunit 13 (LOC111076903), transcript variant X1, mRNA. ACCESSION XM_022370953 VERSION XM_022370953.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022370953.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..735 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..735 /gene="LOC111076903" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111076903" CDS 116..580 /gene="LOC111076903" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13" /protein_id="XP_022226645.1" /db_xref="GeneID:111076903" /translation="MAPAVPQVPPKQDLPPAGGYKKIPFARVLPKSYFTGFTMIGTYV AVTTVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILIAERDREFLRQLRRNRDEEAELM KNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAHADWKSYAKRAHIKLWS" misc_feature 140..535 /gene="LOC111076903" /note="GRIM-19 protein; Region: GRIM-19; pfam06212" /db_xref="CDD:461852" ORIGIN 1 cgtagtcgat agggccatcg gttgtgggcc agccctagtg ttatgcaaaa cgcttcttga 61 catttttgac ggccgatttc ctattttttc aatacaattt ttatagccag tcaccatggc 121 cccggccgtg ccacaagtgc cccctaagca ggacctgcct ccagccggtg gctacaagaa 181 gattcccttt gctcgtgtgc ttcccaagag ctatttcaca ggcttcacca tgattggcac 241 ctatgtggcc gtcaccaccg tcggtctagg aatctactat ctgacggcca agaaggttaa 301 acgcgacgag atcgagatgc gttcggccca gaatgtcatc tttccgatcc tgattgccga 361 gcgcgatcgt gagttcctgc gccagttgcg tcgcaaccgg gacgaggagg ccgagctaat 421 gaagaatgtg cccggctggg aggtgggcac ctggtacggt gagcccgtct tcaagaccct 481 gcccgaggac actctggtaa cgcccatctt caaggagttc tatgcccatg ccgactggaa 541 gtcgtacgcc aagcgtgccc acatcaagct ctggtcgtaa gccaacggga agaacggagc 601 cgcagcagcg tactgctact tagttaatgc atattgtgaa gcttttttgt ttatagaatt 661 gcctaagcgc gcctgctcat tgcactcaat tacatgtcga gagattgatt gaaatgggga 721 aaaaaacgaa acgaa