Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura NADH dehydrogenase [ubiquinone] 1


LOCUS       XM_022370932             725 bp    mRNA    linear   INV 14-MAY-2021
            beta subcomplex subunit 7 (LOC111076893), mRNA.
ACCESSION   XM_022370932
VERSION     XM_022370932.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022370932.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..725
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..725
                     /gene="LOC111076893"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111076893"
     CDS             111..464
                     /gene="LOC111076893"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 beta
                     subcomplex subunit 7"
                     /protein_id="XP_022226624.1"
                     /db_xref="GeneID:111076893"
                     /translation="MGNAVNHYLKPDVTPGPDVVPTFDPLLGFASRKERVMIATQEEM
                     ESVKLPLEDRDYCAHKLIAYQACRSDKFPFVYQCAHEKHEYLTCEYEDYVLRMKEFER
                     ERRLLERQKRLDKAA"
     misc_feature    225..410
                     /gene="LOC111076893"
                     /note="NADH-ubiquinone oxidoreductase B18 subunit
                     (NDUFB7); Region: NDUF_B7; pfam05676"
                     /db_xref="CDD:461710"
ORIGIN      
        1 tttggcctct ttgcacaggt tggcagccct tggcagcagc tgtcaaaggc gaagaagaag
       61 tagagaactg acagcaggcc gcaacaaaat cgacgagaaa acattttacg atgggcaacg
      121 ctgtgaatca ctatctgaag ccagatgtga cacccggtcc ggacgtggtg cccacattcg
      181 atcccctgtt gggatttgcg tcgcgcaagg agcgcgtcat gatcgccacc caggaggaga
      241 tggaatcggt gaagctgccg ctcgaggatc gcgactactg tgcccataag ctgatcgcct
      301 accaggcctg ccgctcggac aagttcccct ttgtctatca gtgtgcgcac gagaagcacg
      361 agtacttgac ctgcgaatac gaggactatg tgctgcgcat gaaggagttt gagcgcgagc
      421 gtcgactgct ggagcgccag aagcgcctgg acaaggccgc ttaggctctg gctctggact
      481 tggtcttgct gtcaatcctt cccccccaca cacacacaca cgccaacaaa caaacccggg
      541 ccactaagct gctgcgtgcg gagtgcagga tgctgcagct gtcactccac acacacacac
      601 acaaccactg cccgttgcag gcgcacgttt ccagctggaa atgtcgataa taaacaccat
      661 gctagtagta atgtggattg gcttactttt tttttagtga attaaatgac aaaactgttg
      721 aaaaa