Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022370931 1830 bp mRNA linear INV 14-MAY-2021 (LOC111076892), mRNA. ACCESSION XM_022370931 VERSION XM_022370931.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022370931.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-183 JAECWW010000165.1 861818-862000 184-561 JAECWW010000165.1 862086-862463 562-721 JAECWW010000165.1 862557-862716 722-816 JAECWW010000165.1 862787-862881 817-1830 JAECWW010000165.1 862883-863896 FEATURES Location/Qualifiers source 1..1830 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1830 /gene="LOC111076892" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111076892" CDS 10..1440 /gene="LOC111076892" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: uncharacterized protein LOC111076892" /protein_id="XP_022226623.2" /db_xref="GeneID:111076892" /translation="MRNIRNLKDPTTTTTTTTWGILLLMLLWLVAPGHTELPKVICRD HDTTITCDCNNEEQAMVLPQLHGAVFQVEVRNCRDLVVEAYALSNTEGLRKISFRQLG QLVLREYALTVPRYASNKALIVEFEAVNLRLIESHAINGNIEEISFVGGRIEQMQPFG FTTTKNSAILLKLDGVTIQRIEGQAFKKFAVEQLTIANCQFLGDLPTRSFYELEVLHE LSMRNNRFQVVHSHAFSFKLVSKLSLSDNHFVAVDGEWLEAQIRDAVTLRVNDFGATS EIAFRSLTVHRSYQLSERLELRFHNNTLRSARPGSGLDSSTAGQQDVAAAAAQPLRFD ERFALSLREVRYVNAWSCYQLDTSVEPPLPRSDFFRLHSEQLLFPRPNANGAKAQQQQ QQQFVPLRQLIAEQCQTTSYVAYIVTGSVLLGLLLLLLLLLLWWRLAQRRKRRKLDVV QPEPRTYKETQIVYQIENAGLLKTDL" misc_feature 580..654 /gene="LOC111076892" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275378" misc_feature 601..756 /gene="LOC111076892" /note="Leucine rich repeat; Region: LRR_8; pfam13855" /db_xref="CDD:404697" misc_feature 655..729 /gene="LOC111076892" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275378" ORIGIN 1 gtaaaaacca tgcgaaatat cagaaatctc aaggatccca ccaccaccac caccaccacc 61 acctggggca tcctgctgtt aatgctgctg tggctggtgg cgcccggaca tacggaattg 121 cccaaagtca tttgtcgcga tcatgacacc accatcacct gtgactgcaa caacgaggag 181 caggccatgg tcctgcccca gctgcatggt gccgtctttc aggtggaggt gcgcaactgt 241 cgcgatcttg tggtggaggc ctatgctctc agcaataccg agggtctgcg caagatctcg 301 ttccggcagc tgggccaatt ggtgctgcgg gagtacgcat tgactgtgcc gcgctacgcc 361 agcaacaagg ctctgattgt cgaattcgag gcggtcaatc tgcggttgat cgagtcgcat 421 gccatcaacg ggaacatcga ggagatctca tttgtgggcg gacgcatcga acagatgcaa 481 ccgtttggtt ttaccaccac caaaaacagt gccatattgc tgaagcttga tggtgtcacc 541 attcagcgga ttgaggggca ggcctttaag aagtttgccg tggagcagct aacaatcgcc 601 aattgccagt tcctgggtga tctgcccaca cgctccttct acgagctgga agtgctccat 661 gagctgagca tgcgcaacaa tcgcttccag gtggtgcatt cgcatgcctt ctcctttaag 721 cttgtctcca agctgagcct cagcgacaat cattttgtgg ctgtggacgg cgagtggctg 781 gaggcgcaga tacgggacgc tgtcacgctg cgggtgaatg attttggggc caccagtgag 841 atagccttcc gcagcctgac cgtccatcgg agctatcagc tcagtgagcg gctggagttg 901 cgcttccaca acaataccct gcgcagtgcc cgccctggat ccgggttgga ttcctcaacg 961 gccggacagc aggatgtcgc agcagcagct gcccagccac tgcgctttga cgagcgcttt 1021 gcactgagtc tgcgtgaggt gcgctacgtg aatgcctgga gctgttacca gctggacaca 1081 agcgtggagc cgccactgcc gcgctccgac ttctttcgcc tgcacagcga gcagctgctg 1141 ttcccgcgtc ccaacgcaaa tggagcgaag gcgcagcagc agcaacagca gcagtttgtg 1201 ccgctccgtc agctgatagc cgagcagtgc caaacgacca gctatgtggc gtacattgtg 1261 acgggcagtg tgctgctggg gctgctgttg ctgctccttt tgctgctgtt gtggtggcgt 1321 ctggcccaga ggcgtaagcg acgcaaactg gacgtggtgc agccggagcc gcgcacctac 1381 aaagagacac agatcgtata ccaaatcgag aatgctggcc tgctgaagac tgatttgtag 1441 acacacacac acacaccaca aagacacaca cacacagaca tcaaaggaca tgtagagaca 1501 ggacgcacaa acaaacaaac acagagctga agagaagcta gagaagcggg tagcgagcgc 1561 acactgaacc accaatccac caatgagtga ccttttgttg taccaaaacc atagcctaaa 1621 acttagctct aaatatctac cacataatta ttaaacctac atatactatt acctatatac 1681 tatgtacgta ttatgtccgt gtatatccag caacataata tttgtcaatt gtaagtcgcc 1741 ctgtaaatag ttattatagc aagggggatg cgattccaca tccaaccata catatgcgaa 1801 gtctattgaa taaatcgagc atcaaacgct