Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111076892


LOCUS       XM_022370931            1830 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111076892), mRNA.
ACCESSION   XM_022370931
VERSION     XM_022370931.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022370931.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-183               JAECWW010000165.1  861818-862000
            184-561             JAECWW010000165.1  862086-862463
            562-721             JAECWW010000165.1  862557-862716
            722-816             JAECWW010000165.1  862787-862881
            817-1830            JAECWW010000165.1  862883-863896
FEATURES             Location/Qualifiers
     source          1..1830
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1830
                     /gene="LOC111076892"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins, and 99% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     17 samples with support for all annotated introns"
                     /db_xref="GeneID:111076892"
     CDS             10..1440
                     /gene="LOC111076892"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein
                     LOC111076892"
                     /protein_id="XP_022226623.2"
                     /db_xref="GeneID:111076892"
                     /translation="MRNIRNLKDPTTTTTTTTWGILLLMLLWLVAPGHTELPKVICRD
                     HDTTITCDCNNEEQAMVLPQLHGAVFQVEVRNCRDLVVEAYALSNTEGLRKISFRQLG
                     QLVLREYALTVPRYASNKALIVEFEAVNLRLIESHAINGNIEEISFVGGRIEQMQPFG
                     FTTTKNSAILLKLDGVTIQRIEGQAFKKFAVEQLTIANCQFLGDLPTRSFYELEVLHE
                     LSMRNNRFQVVHSHAFSFKLVSKLSLSDNHFVAVDGEWLEAQIRDAVTLRVNDFGATS
                     EIAFRSLTVHRSYQLSERLELRFHNNTLRSARPGSGLDSSTAGQQDVAAAAAQPLRFD
                     ERFALSLREVRYVNAWSCYQLDTSVEPPLPRSDFFRLHSEQLLFPRPNANGAKAQQQQ
                     QQQFVPLRQLIAEQCQTTSYVAYIVTGSVLLGLLLLLLLLLLWWRLAQRRKRRKLDVV
                     QPEPRTYKETQIVYQIENAGLLKTDL"
     misc_feature    580..654
                     /gene="LOC111076892"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    601..756
                     /gene="LOC111076892"
                     /note="Leucine rich repeat; Region: LRR_8; pfam13855"
                     /db_xref="CDD:404697"
     misc_feature    655..729
                     /gene="LOC111076892"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
ORIGIN      
        1 gtaaaaacca tgcgaaatat cagaaatctc aaggatccca ccaccaccac caccaccacc
       61 acctggggca tcctgctgtt aatgctgctg tggctggtgg cgcccggaca tacggaattg
      121 cccaaagtca tttgtcgcga tcatgacacc accatcacct gtgactgcaa caacgaggag
      181 caggccatgg tcctgcccca gctgcatggt gccgtctttc aggtggaggt gcgcaactgt
      241 cgcgatcttg tggtggaggc ctatgctctc agcaataccg agggtctgcg caagatctcg
      301 ttccggcagc tgggccaatt ggtgctgcgg gagtacgcat tgactgtgcc gcgctacgcc
      361 agcaacaagg ctctgattgt cgaattcgag gcggtcaatc tgcggttgat cgagtcgcat
      421 gccatcaacg ggaacatcga ggagatctca tttgtgggcg gacgcatcga acagatgcaa
      481 ccgtttggtt ttaccaccac caaaaacagt gccatattgc tgaagcttga tggtgtcacc
      541 attcagcgga ttgaggggca ggcctttaag aagtttgccg tggagcagct aacaatcgcc
      601 aattgccagt tcctgggtga tctgcccaca cgctccttct acgagctgga agtgctccat
      661 gagctgagca tgcgcaacaa tcgcttccag gtggtgcatt cgcatgcctt ctcctttaag
      721 cttgtctcca agctgagcct cagcgacaat cattttgtgg ctgtggacgg cgagtggctg
      781 gaggcgcaga tacgggacgc tgtcacgctg cgggtgaatg attttggggc caccagtgag
      841 atagccttcc gcagcctgac cgtccatcgg agctatcagc tcagtgagcg gctggagttg
      901 cgcttccaca acaataccct gcgcagtgcc cgccctggat ccgggttgga ttcctcaacg
      961 gccggacagc aggatgtcgc agcagcagct gcccagccac tgcgctttga cgagcgcttt
     1021 gcactgagtc tgcgtgaggt gcgctacgtg aatgcctgga gctgttacca gctggacaca
     1081 agcgtggagc cgccactgcc gcgctccgac ttctttcgcc tgcacagcga gcagctgctg
     1141 ttcccgcgtc ccaacgcaaa tggagcgaag gcgcagcagc agcaacagca gcagtttgtg
     1201 ccgctccgtc agctgatagc cgagcagtgc caaacgacca gctatgtggc gtacattgtg
     1261 acgggcagtg tgctgctggg gctgctgttg ctgctccttt tgctgctgtt gtggtggcgt
     1321 ctggcccaga ggcgtaagcg acgcaaactg gacgtggtgc agccggagcc gcgcacctac
     1381 aaagagacac agatcgtata ccaaatcgag aatgctggcc tgctgaagac tgatttgtag
     1441 acacacacac acacaccaca aagacacaca cacacagaca tcaaaggaca tgtagagaca
     1501 ggacgcacaa acaaacaaac acagagctga agagaagcta gagaagcggg tagcgagcgc
     1561 acactgaacc accaatccac caatgagtga ccttttgttg taccaaaacc atagcctaaa
     1621 acttagctct aaatatctac cacataatta ttaaacctac atatactatt acctatatac
     1681 tatgtacgta ttatgtccgt gtatatccag caacataata tttgtcaatt gtaagtcgcc
     1741 ctgtaaatag ttattatagc aagggggatg cgattccaca tccaaccata catatgcgaa
     1801 gtctattgaa taaatcgagc atcaaacgct