PREDICTED: Drosophila obscura lysozyme (LOC111074837), mRNA.

LOCUS       XM_022367798             604 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022367798
VERSION     XM_022367798.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022367798.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 28% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..604
                     /gene="LOC111074837"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 19 Proteins, and 73% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111074837"
     CDS             1..576
                     /gene="LOC111074837"
                     /codon_start=1
                     /product="lysozyme"
                     /protein_id="XP_022223490.2"
                     /db_xref="GeneID:111074837"
                     /translation="MKNDNKAAPLIGHPASAPHRPEGGRVHTRNQMPHLPDTDPQPKA
                     KARASQLFYLGLVLGLLWGPGALAKRYLRCELARKLLDQHGFERSLLSNWICLLEHES
                     ELETTRTTTNPNGSRSLGLFQINSRYCQEGRRGGICNVKCEDLLDENLREAAVCARRI
                     QTTDGFRHWNGWQRYCRNTQNLPNLKVICGI"
     misc_feature    205..558
                     /gene="LOC111074837"
                     /note="C-type invertebrate lysozyme; Region: LYZ_C_invert;
                     cd16899"
                     /db_xref="CDD:381618"
ORIGIN      
        1 atgaaaaacg acaacaaagc ggcgccgctt atcgggcacc cagcatctgc cccacaccga
       61 cccgaaggtg gccgggttca cactcgcaat cagatgccac acttgccaga cacagaccca
      121 cagcccaaag ccaaagccag agcctcacaa ttgttctatt tgggtctggt tctgggtctg
      181 ctgtggggtc ccggggcact ggccaagcgg tatctgcgct gtgagctggc ccgcaagctg
      241 ctcgaccagc acggcttcga gcgtagcctt ctgtccaact ggatctgtct tctggagcac
      301 gagagcgaac tggagacgac ccgcaccact acgaacccca atggatcgcg cagcctgggc
      361 ctgttccaga tcaacagtcg atactgccag gagggcagac gaggaggcat ctgcaacgtc
      421 aaatgcgaag atctgctcga tgagaatctg cgcgaggcgg ccgtctgtgc caggcggatt
      481 caaaccacgg acgggtttcg tcattggaat ggctggcagc gatactgccg caacacccag
      541 aaccttccca atctgaaggt catctgtggc atctaggaaa tggccataaa aaagggggtt
      601 ggtg