Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367795 1629 bp mRNA linear INV 14-MAY-2021 mRNA. ACCESSION XM_022367795 VERSION XM_022367795.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367795.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1629 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1629 /gene="LOC111074834" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111074834" CDS 75..1436 /gene="LOC111074834" /codon_start=1 /product="chitotriosidase-1" /protein_id="XP_022223487.2" /db_xref="GeneID:111074834" /translation="MYLSDTMVHYSRIEDTVPMAMTAKWIGDQQSDASQKRFSRTLIC CSGLLFLIMITAIAVVVVCTGGLQKGGVVSWAAEEEPRVAPHRLVCYYSTSDADALRL LDVPGDLCTHINIGLASLDNATLWLGPQLRQVLQNETLPFRAAHPQVKLLLWIGGADS GSQFARMVANHAMRKQFLRSLKAVLRLYPALDGIDLDWEFPSAYDKERQHLSQLLYEI RQEWRRERRPNALLSLAVAAPEGIAFYAYDTRQINLYADYVNLMAYDFHFYREDTPFT GLNAPLYAHATDTSIMATFNINYTVHWWLQNGLEPQRLVVGLATYGHSFTLVSPLNHR IGAPASGYGKCGQYGFTTLSQTCECAARYLRPLYAYDTETCSPYLSGLQEWISYENQT SIACKTNYIKSLNLGGVMVFSLNTDDLKNSCRFLATSEAADNKPVFPLTQAVKGILEG EGL" misc_feature 336..1418 /gene="LOC111074834" /note="The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have...; Region: GH18_chitinase-like; cl10447" /db_xref="CDD:471972" misc_feature order(345..347,423..425,657..659,663..665,669..671, 864..869,1035..1037,1308..1310) /gene="LOC111074834" /note="active site" /db_xref="CDD:119349" ORIGIN 1 atgttgtttt tgtttgaacc ttaatatgta aataaaaagg acttctgaaa acttgttaat 61 cttgtacaaa atttatgtat ctatcggata ctatggtgca ctacagcagg atcgaggaca 121 ccgttccgat ggccatgact gccaagtgga taggcgacca gcagagcgac gcgtcgcaga 181 agagattttc gcgaactttg atctgttgca gcggcctttt gtttctaatt atgataactg 241 ccatcgccgt ggtggtggtg tgcacgggtg gactgcagaa gggcggcgtg gtgagctggg 301 cagcagaaga ggagccaagg gtggcgcccc atcgattggt ttgctattac tcaacctcgg 361 atgcggatgc actcagactg ctggacgtgc ccggggacct gtgcacgcac atcaacattg 421 gattggccag cctggacaat gccacgctgt ggctgggccc ccaattgcgg caggtgctgc 481 agaacgagac gctgccattc cgggcggccc atccccaggt gaagctgctc ctctggattg 541 gcggcgccga cagtggcagt cagtttgccc gcatggtggc gaatcatgct atgcgcaagc 601 agttcctgcg ctccctcaaa gccgtgttgc ggctgtaccc cgccctggac ggcatcgatc 661 tcgattggga gttccccagt gcctacgaca aggagcgaca gcatctctcc cagctgctct 721 acgagatccg acaagagtgg cgtcgcgagc gccgccccaa tgctctcctc tcgctggccg 781 tggccgcccc cgagggcatc gccttctacg cctacgatac gcggcaaatc aatctctacg 841 cggactatgt caacctgatg gcctacgatt ttcacttcta tcgcgaggac acgcccttca 901 ccggcctcaa cgcccccctg tatgcccacg ccaccgatac gtccatcatg gccaccttca 961 acataaacta cacggtccac tggtggctgc agaacggtct ggagccgcag cgtctggtcg 1021 tcgggctggc gacctatggc cactccttca ctttggtcag tcccttgaat catcggattg 1081 gggcgcccgc ctcgggctat ggaaagtgcg gccagtatgg cttcacgacg ctctcgcaga 1141 cctgcgaatg tgccgccaga tacctgaggc cgctctacgc ctacgacacg gagacctgct 1201 cgccgtattt gagcggcctg caggagtgga tatcgtacga gaaccaaacg agcatcgcct 1261 gcaagacgaa ctacatcaag tcactgaatt tgggcggcgt catggtcttc tcgctgaaca 1321 ctgatgatct aaagaactct tgccgtttcc tggccacatc ggaggcggcg gacaacaagc 1381 cagtatttcc actgacacaa gcggtgaagg gtatcctcga aggagaggga ctgtagatag 1441 actgctagta tcaattctga tgtgtattta aaggatgttt caaaaaggga tgtgccagcc 1501 cctcccagtc tcccccttga actgcacggt ggagagcagt gcgcaaaaac ggaaggggaa 1561 attacttttt gtacatagtc atagacacga taacttttat gtttaagtat aaattaaatt 1621 atcacaatc