Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura chitotriosidase-1 (LOC111074834),


LOCUS       XM_022367795            1629 bp    mRNA    linear   INV 14-MAY-2021
            mRNA.
ACCESSION   XM_022367795
VERSION     XM_022367795.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022367795.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1629
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1629
                     /gene="LOC111074834"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 26 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074834"
     CDS             75..1436
                     /gene="LOC111074834"
                     /codon_start=1
                     /product="chitotriosidase-1"
                     /protein_id="XP_022223487.2"
                     /db_xref="GeneID:111074834"
                     /translation="MYLSDTMVHYSRIEDTVPMAMTAKWIGDQQSDASQKRFSRTLIC
                     CSGLLFLIMITAIAVVVVCTGGLQKGGVVSWAAEEEPRVAPHRLVCYYSTSDADALRL
                     LDVPGDLCTHINIGLASLDNATLWLGPQLRQVLQNETLPFRAAHPQVKLLLWIGGADS
                     GSQFARMVANHAMRKQFLRSLKAVLRLYPALDGIDLDWEFPSAYDKERQHLSQLLYEI
                     RQEWRRERRPNALLSLAVAAPEGIAFYAYDTRQINLYADYVNLMAYDFHFYREDTPFT
                     GLNAPLYAHATDTSIMATFNINYTVHWWLQNGLEPQRLVVGLATYGHSFTLVSPLNHR
                     IGAPASGYGKCGQYGFTTLSQTCECAARYLRPLYAYDTETCSPYLSGLQEWISYENQT
                     SIACKTNYIKSLNLGGVMVFSLNTDDLKNSCRFLATSEAADNKPVFPLTQAVKGILEG
                     EGL"
     misc_feature    336..1418
                     /gene="LOC111074834"
                     /note="The GH18 (glycosyl hydrolase, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
                     major component of the cell wall of fungi and the
                     exoskeleton of arthropods. Chitinases have...; Region:
                     GH18_chitinase-like; cl10447"
                     /db_xref="CDD:471972"
     misc_feature    order(345..347,423..425,657..659,663..665,669..671,
                     864..869,1035..1037,1308..1310)
                     /gene="LOC111074834"
                     /note="active site"
                     /db_xref="CDD:119349"
ORIGIN      
        1 atgttgtttt tgtttgaacc ttaatatgta aataaaaagg acttctgaaa acttgttaat
       61 cttgtacaaa atttatgtat ctatcggata ctatggtgca ctacagcagg atcgaggaca
      121 ccgttccgat ggccatgact gccaagtgga taggcgacca gcagagcgac gcgtcgcaga
      181 agagattttc gcgaactttg atctgttgca gcggcctttt gtttctaatt atgataactg
      241 ccatcgccgt ggtggtggtg tgcacgggtg gactgcagaa gggcggcgtg gtgagctggg
      301 cagcagaaga ggagccaagg gtggcgcccc atcgattggt ttgctattac tcaacctcgg
      361 atgcggatgc actcagactg ctggacgtgc ccggggacct gtgcacgcac atcaacattg
      421 gattggccag cctggacaat gccacgctgt ggctgggccc ccaattgcgg caggtgctgc
      481 agaacgagac gctgccattc cgggcggccc atccccaggt gaagctgctc ctctggattg
      541 gcggcgccga cagtggcagt cagtttgccc gcatggtggc gaatcatgct atgcgcaagc
      601 agttcctgcg ctccctcaaa gccgtgttgc ggctgtaccc cgccctggac ggcatcgatc
      661 tcgattggga gttccccagt gcctacgaca aggagcgaca gcatctctcc cagctgctct
      721 acgagatccg acaagagtgg cgtcgcgagc gccgccccaa tgctctcctc tcgctggccg
      781 tggccgcccc cgagggcatc gccttctacg cctacgatac gcggcaaatc aatctctacg
      841 cggactatgt caacctgatg gcctacgatt ttcacttcta tcgcgaggac acgcccttca
      901 ccggcctcaa cgcccccctg tatgcccacg ccaccgatac gtccatcatg gccaccttca
      961 acataaacta cacggtccac tggtggctgc agaacggtct ggagccgcag cgtctggtcg
     1021 tcgggctggc gacctatggc cactccttca ctttggtcag tcccttgaat catcggattg
     1081 gggcgcccgc ctcgggctat ggaaagtgcg gccagtatgg cttcacgacg ctctcgcaga
     1141 cctgcgaatg tgccgccaga tacctgaggc cgctctacgc ctacgacacg gagacctgct
     1201 cgccgtattt gagcggcctg caggagtgga tatcgtacga gaaccaaacg agcatcgcct
     1261 gcaagacgaa ctacatcaag tcactgaatt tgggcggcgt catggtcttc tcgctgaaca
     1321 ctgatgatct aaagaactct tgccgtttcc tggccacatc ggaggcggcg gacaacaagc
     1381 cagtatttcc actgacacaa gcggtgaagg gtatcctcga aggagaggga ctgtagatag
     1441 actgctagta tcaattctga tgtgtattta aaggatgttt caaaaaggga tgtgccagcc
     1501 cctcccagtc tcccccttga actgcacggt ggagagcagt gcgcaaaaac ggaaggggaa
     1561 attacttttt gtacatagtc atagacacga taacttttat gtttaagtat aaattaaatt
     1621 atcacaatc