Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367785 1497 bp mRNA linear INV 14-MAY-2021 TOM70-like (LOC111074827), mRNA. ACCESSION XM_022367785 VERSION XM_022367785.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367785.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1497 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1497 /gene="LOC111074827" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:111074827" CDS 1..1497 /gene="LOC111074827" /codon_start=1 /product="mitochondrial import receptor subunit TOM70-like" /protein_id="XP_022223477.2" /db_xref="GeneID:111074827" /translation="MDERSLVAAIDACDKALAREIRDHRLGMSELYQTRVVWQVVRQN WAEVKADCAKALAYNCRNGTIYLSRARAHDATGDTEQCLSDLAACRILMRDSRTADCS PERERIDKFWQRVLLQRARFEATQIMSQRGPLFPSKLQINTYMSAFIADPLQTGNFDR SLRGFPRAYWAFREERFEDVIPACTEEIESAEDWAQHKAEARLMRGTFHLLCGSSAEC QQDFDALIGDPQVDATLRAYALIRSAALRFQLCRGHEAMDAFEQAERLVRDNPDVHHQ RGLILRKLQQLETALMDFEMAARLAPGHVGPVALKHFTEYHLAARLNSPPRMETALRK LGEMSAAYPNTIDGPVMKGRLMTERKDFVGALACFEEAIELAPKNSMLMTHWAVMELR RHNNAELIMPILYEAIELDPRYHMPYGVLATLELKRNNPDKAVELLRQSCLHCGTYNE VLHACCLRNAIVARTAAKRSLANDLGLDLGIDLDIDLAMVRHDQPPTV" misc_feature <94..1362 /gene="LOC111074827" /note="mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70); Region: 3a0801s09; TIGR00990" /db_xref="CDD:273380" misc_feature 595..678 /gene="LOC111074827" /note="TPR repeat [structural motif]; Region: TPR repeat" /db_xref="CDD:276809" misc_feature 709..795 /gene="LOC111074827" /note="TPR repeat [structural motif]; Region: TPR repeat" /db_xref="CDD:276809" misc_feature 808..900 /gene="LOC111074827" /note="TPR repeat [structural motif]; Region: TPR repeat" /db_xref="CDD:276809" misc_feature order(1060..1065,1069..1071,1141..1143,1150..1155, 1162..1167,1171..1176,1246..1248,1255..1260,1267..1272, 1279..1281) /gene="LOC111074827" /note="putative protein binding surface [polypeptide binding]; other site" /db_xref="CDD:276809" misc_feature 1135..1230 /gene="LOC111074827" /note="TPR repeat [structural motif]; Region: TPR repeat" /db_xref="CDD:276809" misc_feature 1243..1320 /gene="LOC111074827" /note="TPR repeat [structural motif]; Region: TPR repeat" /db_xref="CDD:276809" ORIGIN 1 atggatgaac gaagtttggt cgctgcgatc gacgcctgtg acaaggcgct ggcgagggag 61 atcagggatc atcgcctggg catgtccgag ctgtatcaga cccgcgtcgt ctggcaggtg 121 gtgcgccaga actgggccga ggtcaaggcg gactgcgcca aggccctggc gtacaactgt 181 cgtaatggca cgatctattt gagtcgggct cgtgcccacg acgccaccgg tgacacagag 241 cagtgcctca gcgatctggc ggcctgccgc atcctgatgc gcgactcaag gaccgccgat 301 tgcagccccg agcgcgagcg catcgacaaa ttctggcagc gcgtcctcct gcagcgcgcc 361 cgcttcgagg ccactcagat catgagccaa cggggtccgc tctttccctc aaagctgcaa 421 attaacacgt acatgagcgc gttcatcgcc gaccccctgc agacgggcaa cttcgatcga 481 tcgctgcgcg gcttcccccg cgcctactgg gcgttccggg aggagcgctt cgaggatgtg 541 atccctgcct gcacggagga gatcgagtcc gccgaggact gggcccagca caaggcggag 601 gctaggctga tgcgcggcac cttccacctg ctgtgcggct cgagcgcgga gtgccagcag 661 gacttcgatg cactgatcgg cgatccgcag gtggatgcca cattgcgtgc ctatgcgctg 721 atccggagcg ctgccctccg cttccagctg tgcagggggc acgaggcgat ggacgccttc 781 gagcaggccg agcggctggt gcgcgacaat cccgatgtgc accaccagcg cggcctgatc 841 ctccgcaagc tgcagcagct tgagaccgcc ctgatggact tcgaaatggc cgcccgactg 901 gcgcccggcc acgtcggtcc cgtggccttg aagcacttca ccgagtacca tctggcggca 961 cgcctgaaca gccctccgcg catggagacg gcgctccgga agctgggcga gatgtccgct 1021 gcgtacccga acaccatcga tggccccgtg atgaagggca ggctgatgac cgagcgcaag 1081 gatttcgtcg gggcgctggc ctgcttcgag gaggccatcg aactggcgcc caagaattcc 1141 atgctgatga cccactgggc cgtcatggag ctcaggcggc ataacaatgc ggagctgatt 1201 atgccgatcc tgtacgaggc catcgagctg gatccccggt accacatgcc ctacggcgtc 1261 ctggccacgc tggagctcaa gcggaacaac cccgacaagg ccgtcgagct actgcgccag 1321 tcctgcctcc attgcggcac ctacaatgag gtgctgcacg cctgctgcct gcgcaatgcg 1381 atagtggcgc gcaccgctgc caagcggagt ttggccaatg atctgggcct cgatctgggc 1441 attgatctgg acatcgatct ggccatggtt cggcacgacc agccacccac agtttaa