Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111074825


LOCUS       XM_022367782            1123 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111074825), transcript variant X2, mRNA.
ACCESSION   XM_022367782
VERSION     XM_022367782.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022367782.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1123
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1123
                     /gene="LOC111074825"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074825"
     CDS             16..1011
                     /gene="LOC111074825"
                     /codon_start=1
                     /product="uncharacterized protein LOC111074825 isoform X2"
                     /protein_id="XP_022223474.1"
                     /db_xref="GeneID:111074825"
                     /translation="MFSYKLNLRSSNETLRRAIRPLGFDLQELRLVIEVSPLRHLCPF
                     LFATDNIYEIMDGFNSLMNGETIAFGAGPLGTLMVAGIMVYMLNHAELQTSHVKRTLF
                     LQRCFNYMACTEETHVNDLCAAILNKINIRDSDHMLNLILCCHHASPLCTMAQLVCSC
                     LLWAVLDWLTDMGMGSHRLRPYSELKLAISLVNPSVCVESYLHGLNLTVRVVSALLVV
                     GPYGSTEQICNEVGVAPGLFVLPDDDASIVFRWLSAVVNELRHSMGQADGHMEERIVV
                     LEVACDLMLMMHEHLLIIYQRMRDLDPEAEILPLPDLPPEPEVAADEVANENNSV"
ORIGIN      
        1 cgaaaaggag gagaaatgtt tagctacaaa ttgaatcttc gttcatccaa cgagacgctt
       61 cggcgcgcca tacgtcccct gggcttcgat ctgcaggaat tgcgtttggt catcgaggtg
      121 tcgccgcttc gtcatctgtg ccccttctta tttgccactg ataacatata cgagataatg
      181 gacggtttca attccttgat gaacggcgaa acgatcgcgt ttggtgccgg ccccctgggc
      241 accctaatgg ttgctggaat aatggtgtat atgctgaacc acgccgagct gcagacgagc
      301 catgtaaagc gcaccctgtt tctgcagcgc tgcttcaact acatggcctg caccgaggag
      361 acgcacgtca acgatctatg cgccgccatc ctgaacaaga tcaacatcag agattcggac
      421 cacatgctaa acctgatcct ttgctgccac catgccagcc ccttgtgtac catggcccag
      481 ttggtgtgca gctgccttct ctgggccgtg ctcgactggc tgacggatat gggcatgggc
      541 tcacaccgcc tgcgccccta ctcggagctg aagctggcca tcagcctagt gaatcccagc
      601 gtctgtgtgg agtcctattt gcacggcctc aatctgactg tgcgcgtcgt ctctgccctg
      661 ctcgtggtgg gcccttacgg cagcaccgag cagatatgca acgaggtcgg tgtggcgccc
      721 ggtttgttcg tgctgcccga cgacgatgcc tccatcgtgt tccgctggct tagcgccgtt
      781 gtcaacgagc tgcgccacag catgggccag gcggatggcc acatggagga gcgaattgtg
      841 gtgctggagg tggcctgcga cctcatgctc atgatgcatg agcatctgct aattatttat
      901 cagcgcatgc gcgacctcga cccagaggca gaaatacttc cgctacccga cctgccgcca
      961 gagcccgagg tggccgccga cgaggtggcg aacgagaaca attctgttta atcttgtttc
     1021 acaattcaat catttgaatc atttgtaata tccactcact ttttctataa tacccaatcg
     1081 aaatacaccc agcccggctt ggccggtttc ttctttgatc tga