Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367782 1123 bp mRNA linear INV 14-MAY-2021 (LOC111074825), transcript variant X2, mRNA. ACCESSION XM_022367782 VERSION XM_022367782.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367782.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1123 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1123 /gene="LOC111074825" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:111074825" CDS 16..1011 /gene="LOC111074825" /codon_start=1 /product="uncharacterized protein LOC111074825 isoform X2" /protein_id="XP_022223474.1" /db_xref="GeneID:111074825" /translation="MFSYKLNLRSSNETLRRAIRPLGFDLQELRLVIEVSPLRHLCPF LFATDNIYEIMDGFNSLMNGETIAFGAGPLGTLMVAGIMVYMLNHAELQTSHVKRTLF LQRCFNYMACTEETHVNDLCAAILNKINIRDSDHMLNLILCCHHASPLCTMAQLVCSC LLWAVLDWLTDMGMGSHRLRPYSELKLAISLVNPSVCVESYLHGLNLTVRVVSALLVV GPYGSTEQICNEVGVAPGLFVLPDDDASIVFRWLSAVVNELRHSMGQADGHMEERIVV LEVACDLMLMMHEHLLIIYQRMRDLDPEAEILPLPDLPPEPEVAADEVANENNSV" ORIGIN 1 cgaaaaggag gagaaatgtt tagctacaaa ttgaatcttc gttcatccaa cgagacgctt 61 cggcgcgcca tacgtcccct gggcttcgat ctgcaggaat tgcgtttggt catcgaggtg 121 tcgccgcttc gtcatctgtg ccccttctta tttgccactg ataacatata cgagataatg 181 gacggtttca attccttgat gaacggcgaa acgatcgcgt ttggtgccgg ccccctgggc 241 accctaatgg ttgctggaat aatggtgtat atgctgaacc acgccgagct gcagacgagc 301 catgtaaagc gcaccctgtt tctgcagcgc tgcttcaact acatggcctg caccgaggag 361 acgcacgtca acgatctatg cgccgccatc ctgaacaaga tcaacatcag agattcggac 421 cacatgctaa acctgatcct ttgctgccac catgccagcc ccttgtgtac catggcccag 481 ttggtgtgca gctgccttct ctgggccgtg ctcgactggc tgacggatat gggcatgggc 541 tcacaccgcc tgcgccccta ctcggagctg aagctggcca tcagcctagt gaatcccagc 601 gtctgtgtgg agtcctattt gcacggcctc aatctgactg tgcgcgtcgt ctctgccctg 661 ctcgtggtgg gcccttacgg cagcaccgag cagatatgca acgaggtcgg tgtggcgccc 721 ggtttgttcg tgctgcccga cgacgatgcc tccatcgtgt tccgctggct tagcgccgtt 781 gtcaacgagc tgcgccacag catgggccag gcggatggcc acatggagga gcgaattgtg 841 gtgctggagg tggcctgcga cctcatgctc atgatgcatg agcatctgct aattatttat 901 cagcgcatgc gcgacctcga cccagaggca gaaatacttc cgctacccga cctgccgcca 961 gagcccgagg tggccgccga cgaggtggcg aacgagaaca attctgttta atcttgtttc 1021 acaattcaat catttgaatc atttgtaata tccactcact ttttctataa tacccaatcg 1081 aaatacaccc agcccggctt ggccggtttc ttctttgatc tga