Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura barH-like 1 homeobox protein


LOCUS       XM_022367778             993 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111074820), mRNA.
ACCESSION   XM_022367778
VERSION     XM_022367778.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022367778.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..993
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..993
                     /gene="LOC111074820"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111074820"
     CDS             50..889
                     /gene="LOC111074820"
                     /codon_start=1
                     /product="barH-like 1 homeobox protein"
                     /protein_id="XP_022223470.1"
                     /db_xref="GeneID:111074820"
                     /translation="MQSSKSFLIRDLLGDLINRRQTADSDIELSNDDSDIDIEDRSTP
                     DSTAHGCQQDLLLSHHHFHHNDDSSVESCGTATPGPGSGSGVGVSAGLSAAAAAAGVA
                     AGLLAAAASGASSSDPAAGGGGGSSSYADHKLQMSKSGRKPRRRRTAFTHAQLAYLER
                     KFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATLEKD
                     FGVPEGGGGGGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVSYVHG
                     CPM"
     misc_feature    479..649
                     /gene="LOC111074820"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
        1 aacggtacag gaaaccgcaa cctgaaacct gaaaaaagct aaaaccaaaa tgcaaagttc
       61 gaaatcgttt ttaatacgcg acctgctggg agacctgatc aatcggcggc aaacggcgga
      121 ttcggacatc gaactctcca acgatgattc ggacattgat atcgaggatc gttccactcc
      181 ggactcaacg gctcacggct gccagcagga tctgctgctg tcccatcacc attttcacca
      241 caacgacgac tccagcgtgg agtcttgcgg cacggccaca ccgggtccgg gctcgggctc
      301 gggcgttggc gtgagtgcgg gtctgagtgc cgcagctgca gcggcgggcg tggcagccgg
      361 cctactggca gcggcggcca gcggtgccag cagcagcgat ccagccgctg gtggcggcgg
      421 cggcagcagc agctacgcgg atcacaagct acagatgagc aagagcggac gcaagccgag
      481 gcggcgacgc acggccttca cccacgccca gctggcgtat ttggagcgaa agtttcggtg
      541 ccagaagtac ctcagcgtgg ccgatcgcag cgatgtggcc gagacgctaa atctgtccga
      601 aacgcaggtg aagacctggt accagaatcg acgcaccaaa tggaagcgac agaaccagct
      661 gcgtctggag cagttgcgcc accaggccac gctcgagaag gactttggtg tgcccgaggg
      721 cggtggtggt ggcgggggct tgggctgctg ccccagcggc ttgagcagct cgttcagtgc
      781 cgctgctgcc gcggctgctg cggccagcaa tccgtgcaac ttcttgacct ccgccgcagc
      841 ggcggcaata ttccggaatg tgagctatgt gcacggctgc cccatgtaga gaggccccaa
      901 acaatctgat acccagataa ccagtggcct atttgtatat atatattatg ggaaatttaa
      961 aaatggttct tgtgcaataa caaatcccaa tgt