Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367778 993 bp mRNA linear INV 14-MAY-2021 (LOC111074820), mRNA. ACCESSION XM_022367778 VERSION XM_022367778.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367778.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..993 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..993 /gene="LOC111074820" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:111074820" CDS 50..889 /gene="LOC111074820" /codon_start=1 /product="barH-like 1 homeobox protein" /protein_id="XP_022223470.1" /db_xref="GeneID:111074820" /translation="MQSSKSFLIRDLLGDLINRRQTADSDIELSNDDSDIDIEDRSTP DSTAHGCQQDLLLSHHHFHHNDDSSVESCGTATPGPGSGSGVGVSAGLSAAAAAAGVA AGLLAAAASGASSSDPAAGGGGGSSSYADHKLQMSKSGRKPRRRRTAFTHAQLAYLER KFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATLEKD FGVPEGGGGGGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVSYVHG CPM" misc_feature 479..649 /gene="LOC111074820" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" ORIGIN 1 aacggtacag gaaaccgcaa cctgaaacct gaaaaaagct aaaaccaaaa tgcaaagttc 61 gaaatcgttt ttaatacgcg acctgctggg agacctgatc aatcggcggc aaacggcgga 121 ttcggacatc gaactctcca acgatgattc ggacattgat atcgaggatc gttccactcc 181 ggactcaacg gctcacggct gccagcagga tctgctgctg tcccatcacc attttcacca 241 caacgacgac tccagcgtgg agtcttgcgg cacggccaca ccgggtccgg gctcgggctc 301 gggcgttggc gtgagtgcgg gtctgagtgc cgcagctgca gcggcgggcg tggcagccgg 361 cctactggca gcggcggcca gcggtgccag cagcagcgat ccagccgctg gtggcggcgg 421 cggcagcagc agctacgcgg atcacaagct acagatgagc aagagcggac gcaagccgag 481 gcggcgacgc acggccttca cccacgccca gctggcgtat ttggagcgaa agtttcggtg 541 ccagaagtac ctcagcgtgg ccgatcgcag cgatgtggcc gagacgctaa atctgtccga 601 aacgcaggtg aagacctggt accagaatcg acgcaccaaa tggaagcgac agaaccagct 661 gcgtctggag cagttgcgcc accaggccac gctcgagaag gactttggtg tgcccgaggg 721 cggtggtggt ggcgggggct tgggctgctg ccccagcggc ttgagcagct cgttcagtgc 781 cgctgctgcc gcggctgctg cggccagcaa tccgtgcaac ttcttgacct ccgccgcagc 841 ggcggcaata ttccggaatg tgagctatgt gcacggctgc cccatgtaga gaggccccaa 901 acaatctgat acccagataa ccagtggcct atttgtatat atatattatg ggaaatttaa 961 aaatggttct tgtgcaataa caaatcccaa tgt