Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367757 1559 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022367757 VERSION XM_022367757.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367757.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1559 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1559 /gene="LOC111074806" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111074806" CDS 61..1464 /gene="LOC111074806" /codon_start=1 /product="aladin" /protein_id="XP_022223449.2" /db_xref="GeneID:111074806" /translation="MAALSNLKQCPPFSALADPSFRPNYIPELDNYPRIQLKSELHNS SAHRFYGGQGFVPVNEGVLKRIIRTFFEGGFWESLSETRSEKTREQAPWLGRTGDYIS QLLDIANTLKLKVFPHTQDVSAERIAQYVETRDWTDSDVRFMAWNCHVFKLAVAGIDD VVRIYAKNTTNAATPVLKSATQTQITCMAWRPLSATEIVIGCRQGLCFWVVDNTMILG RTNSPSQIFKHPANLPITSMQWNKVGNLLATASIGDRSIIIWQPDSALMEPLKRLGPP GSLLKWSPGNDWLFAGTVDRVFRVWNCHNHWTTERWTCGNGGHVQTACWSPCGRFLLF VSTTEPILYRLQFVQQTMLKSTKDEKEVLPIADLNACSADENRSLIGGPVQQLAWCPH GNYLVITYKSTNHISVFRTFITKYDLQISPAFYLSGENAAEYPSFVCFQPLYKDDDRS IVTIAWSSGRIQYYAFD" misc_feature 487..597 /gene="LOC111074806" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature <517..1068 /gene="LOC111074806" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 616..747 /gene="LOC111074806" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 763..882 /gene="LOC111074806" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 892..999 /gene="LOC111074806" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 tgccgcactt ttactctttt gggttggcgt gggttatgtt tacattgaaa tcaaaagtaa 61 atggcagcgt taagcaatct gaaacaatgc ccgccgttca gcgccctggc ggatccgtcg 121 tttcgtccca attatattcc tgagctggac aactacccca ggatacagct gaagagcgag 181 ctacacaatt catcggcgca tcgtttttat ggcggtcagg gttttgtgcc ggtaaatgaa 241 ggtgtgctga aacgcatcat tcgcaccttc tttgagggtg gcttctggga gtcgctgtcc 301 gaaactcgca gcgaaaagac tcgcgaacag gctccgtggt tgggcagaac cggtgactac 361 atatcccagc tgctggacat cgccaatacg cttaagttga aagtattccc gcacacacag 421 gatgtgagtg ccgagcggat cgcccagtat gtggagacca gggattggac agatagcgat 481 gtgcggttca tggcatggaa ctgtcatgtc ttcaagctag ccgtagctgg cattgacgat 541 gtggtgcgca tctacgccaa gaacaccacc aatgcagcga cacccgtctt gaagagtgca 601 actcagacac aaataacgtg catggcctgg cgtccactga gtgccacgga gattgtgatt 661 ggctgccgtc agggtctctg cttctgggta gtggacaaca ccatgattct gggacgtacc 721 aattcgccca gtcagatctt taagcatccc gctaacctac ccatcacctc tatgcagtgg 781 aacaaggttg gtaacctatt ggcgaccgct tccattggcg atcgctcgat catcatctgg 841 cagccggaca gtgcactaat ggagccgctc aagagactgg gcccgcccgg atccctgctc 901 aagtggtcac cgggcaacga ttggctcttc gctggcaccg tcgatcgagt atttcgtgtg 961 tggaactgcc acaaccattg gaccactgag cgttggacgt gcggcaacgg tggccatgtc 1021 cagactgcct gctggtcacc ctgtggccgc ttcctgctct ttgtcagtac gaccgagccg 1081 attctctatc gactgcagtt cgtccagcaa actatgttga aatcgactaa ggacgagaag 1141 gaggtactgc ccatagcgga tctaaatgct tgcagtgccg atgagaatag atcgctgatc 1201 ggtggccctg tccagcagct ggcctggtgt ccgcatggca actatttggt gatcacctac 1261 aagtccacca atcacatttc cgttttccgc acattcatca caaagtacga cctgcaaatt 1321 tcgcccgcct tttatctcag tggcgagaac gcagccgagt atcccagttt cgtttgcttc 1381 cagccgctgt acaaggatga cgatcgatct attgtgacca ttgcgtggtc ctcgggacgt 1441 attcagtact atgccttcga ttgatggccg atggccggga gaattctcag gatggtcgtt 1501 ttgtattttt gtattctata aagtgtttgt tagtgaataa aattgaaaga gaacaacaa