Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura transcription initiation factor TFIID


LOCUS       XM_022367756            1340 bp    mRNA    linear   INV 14-MAY-2021
            subunit 8 (LOC111074805), mRNA.
ACCESSION   XM_022367756
VERSION     XM_022367756.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022367756.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1340
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1340
                     /gene="LOC111074805"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 97% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111074805"
     CDS             106..1077
                     /gene="LOC111074805"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit 8"
                     /protein_id="XP_022223448.1"
                     /db_xref="GeneID:111074805"
                     /translation="MDKIESVSTPNVDVYRRLLGKVISQLLLDKGAGQCSAQCLETLT
                     EMLQAFIVELGNSAHNYCELSGRTMATVGDVSMALISMGQNIGSLEGYLRREPHVPVQ
                     LPPQQTQQRTLSLLQAGTKASHPPYVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREK
                     AACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACNPSLPPYYSALNPTDQVFDF
                     EELEYHYLVANRTEDAPSKEDGDEGDSDNEDLEGDKSKEDKQELEIKPNSTTNKAILE
                     NPNIDNPYLRAATLPKRTKLPSSPATVAPTRSLSRGPSTLAITKTAT"
     misc_feature    145..390
                     /gene="LOC111074805"
                     /note="histone-fold domain found in transcription
                     initiation factor TFIID subunit 8 (TAF8) and similar
                     proteins; Region: HFD_TAF8; cd22918"
                     /db_xref="CDD:467043"
     misc_feature    order(145..147,175..177,199..210,280..282,286..288,
                     292..297,304..306,316..318,346..348)
                     /gene="LOC111074805"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    order(148..150,157..162,169..174,178..186,193..204,
                     211..213,217..222,229..234,241..249,253..261,265..273,
                     277..282,289..291,313..321,328..333,340..342,355..357,
                     361..363,367..375,379..390)
                     /gene="LOC111074805"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467043"
     misc_feature    481..642
                     /gene="LOC111074805"
                     /note="TATA Binding Protein (TBP) Associated Factor 8;
                     Region: TAF8; cd08049"
                     /db_xref="CDD:176263"
ORIGIN      
        1 tcagtgacag tgcagccctg tgtagaacag ctgaaccacg aaactcacag caaattgttt
       61 aaaattttca aaagtattca actaaaagtg aaatactctt aatcaatgga caagatcgaa
      121 tctgtatcca cacccaacgt tgacgtttac cgccgcctgc tcggcaaggt aatctcgcag
      181 ctgctgctgg acaagggggc cggccaatgc agtgcacagt gcctggagac gctcacggaa
      241 atgctgcagg cgtttattgt ggagttggga aactcggcgc acaactactg cgagctcagt
      301 gggcgcacca tggcgacggt gggcgatgtg agcatggccc tcatcagcat gggccagaac
      361 attggcagtc tggagggtta ccttcgccgt gaaccgcatg tgccagtgca actgccgcca
      421 cagcagactc aacagcgcac actgagcctt ctgcaggcgg gcaccaaggc atcgcaccca
      481 ccctatgtcc ccagctactt tccacccatg ccagatccgc atgcctacat tcgcacgccg
      541 acccacaagc agccggtgac ggagtacgag gcgatccggg aaaaggctgc ctgccagaag
      601 cgggacattg agaaggctct gaccaagttc ctgtgcaaga caactgaaac gaataatctg
      661 tttcccaccg aagacaatat gtttccctta attgcgtgca acccctcgct gccgccctat
      721 tattcagcct tgaatcccac ggatcaggtc ttcgattttg aggagctgga gtatcactac
      781 ctggtggcaa atcgaacaga ggatgcgccc agcaaagagg atggcgatga aggtgacagc
      841 gacaacgaag atctcgaggg tgataaatcg aaggaggaca agcaggagct ggaaatcaag
      901 cccaattcca ccaccaacaa ggccatactt gagaatccga acatagacaa tccatatttg
      961 cgggccgcca ccttgccaaa gcgcaccaag ctcccttcct caccggccac agtagcgccg
     1021 acacgcagtc tgtccagagg accttccacc ctggctataa caaaaactgc tacctaagac
     1081 ttggactaca cataatatac tattaattca ttaattaatt aacatttaga tataattctc
     1141 tagaaattaa tacgctactg atggttgatt tcacgcagat ctactacatt gttctcccat
     1201 gcaaatactg aactgaacag agcctgatgg aacaagacaa taaaagggac ttcttaaaat
     1261 tagccaatct tgttaaaaat gtattgctag ctagtaataa taaacggaac attcgaggaa
     1321 tatccatttc caaccaggaa