Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022367756 1340 bp mRNA linear INV 14-MAY-2021 subunit 8 (LOC111074805), mRNA. ACCESSION XM_022367756 VERSION XM_022367756.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022367756.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1340 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1340 /gene="LOC111074805" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111074805" CDS 106..1077 /gene="LOC111074805" /codon_start=1 /product="transcription initiation factor TFIID subunit 8" /protein_id="XP_022223448.1" /db_xref="GeneID:111074805" /translation="MDKIESVSTPNVDVYRRLLGKVISQLLLDKGAGQCSAQCLETLT EMLQAFIVELGNSAHNYCELSGRTMATVGDVSMALISMGQNIGSLEGYLRREPHVPVQ LPPQQTQQRTLSLLQAGTKASHPPYVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREK AACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACNPSLPPYYSALNPTDQVFDF EELEYHYLVANRTEDAPSKEDGDEGDSDNEDLEGDKSKEDKQELEIKPNSTTNKAILE NPNIDNPYLRAATLPKRTKLPSSPATVAPTRSLSRGPSTLAITKTAT" misc_feature 145..390 /gene="LOC111074805" /note="histone-fold domain found in transcription initiation factor TFIID subunit 8 (TAF8) and similar proteins; Region: HFD_TAF8; cd22918" /db_xref="CDD:467043" misc_feature order(145..147,175..177,199..210,280..282,286..288, 292..297,304..306,316..318,346..348) /gene="LOC111074805" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467043" misc_feature order(148..150,157..162,169..174,178..186,193..204, 211..213,217..222,229..234,241..249,253..261,265..273, 277..282,289..291,313..321,328..333,340..342,355..357, 361..363,367..375,379..390) /gene="LOC111074805" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:467043" misc_feature 481..642 /gene="LOC111074805" /note="TATA Binding Protein (TBP) Associated Factor 8; Region: TAF8; cd08049" /db_xref="CDD:176263" ORIGIN 1 tcagtgacag tgcagccctg tgtagaacag ctgaaccacg aaactcacag caaattgttt 61 aaaattttca aaagtattca actaaaagtg aaatactctt aatcaatgga caagatcgaa 121 tctgtatcca cacccaacgt tgacgtttac cgccgcctgc tcggcaaggt aatctcgcag 181 ctgctgctgg acaagggggc cggccaatgc agtgcacagt gcctggagac gctcacggaa 241 atgctgcagg cgtttattgt ggagttggga aactcggcgc acaactactg cgagctcagt 301 gggcgcacca tggcgacggt gggcgatgtg agcatggccc tcatcagcat gggccagaac 361 attggcagtc tggagggtta ccttcgccgt gaaccgcatg tgccagtgca actgccgcca 421 cagcagactc aacagcgcac actgagcctt ctgcaggcgg gcaccaaggc atcgcaccca 481 ccctatgtcc ccagctactt tccacccatg ccagatccgc atgcctacat tcgcacgccg 541 acccacaagc agccggtgac ggagtacgag gcgatccggg aaaaggctgc ctgccagaag 601 cgggacattg agaaggctct gaccaagttc ctgtgcaaga caactgaaac gaataatctg 661 tttcccaccg aagacaatat gtttccctta attgcgtgca acccctcgct gccgccctat 721 tattcagcct tgaatcccac ggatcaggtc ttcgattttg aggagctgga gtatcactac 781 ctggtggcaa atcgaacaga ggatgcgccc agcaaagagg atggcgatga aggtgacagc 841 gacaacgaag atctcgaggg tgataaatcg aaggaggaca agcaggagct ggaaatcaag 901 cccaattcca ccaccaacaa ggccatactt gagaatccga acatagacaa tccatatttg 961 cgggccgcca ccttgccaaa gcgcaccaag ctcccttcct caccggccac agtagcgccg 1021 acacgcagtc tgtccagagg accttccacc ctggctataa caaaaactgc tacctaagac 1081 ttggactaca cataatatac tattaattca ttaattaatt aacatttaga tataattctc 1141 tagaaattaa tacgctactg atggttgatt tcacgcagat ctactacatt gttctcccat 1201 gcaaatactg aactgaacag agcctgatgg aacaagacaa taaaagggac ttcttaaaat 1261 tagccaatct tgttaaaaat gtattgctag ctagtaataa taaacggaac attcgaggaa 1321 tatccatttc caaccaggaa