PREDICTED: Drosophila obscura T-cell acute lymphocytic leukemia

LOCUS       XM_022364372            1231 bp    mRNA    linear   INV 14-MAY-2021
            protein 1 (LOC111072469), mRNA.
ACCESSION   XM_022364372
VERSION     XM_022364372.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364372.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1231
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1231
                     /gene="LOC111072469"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 12 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072469"
     CDS             1..1071
                     /gene="LOC111072469"
                     /codon_start=1
                     /product="T-cell acute lymphocytic leukemia protein 1"
                     /protein_id="XP_022220064.2"
                     /db_xref="GeneID:111072469"
                     /translation="MAWLPSSSNGSDNADERSTASSASASSAAGSSGANGSPRPAAGA
                     APATASAGARQPPALLRHATPYLQPKTESISDGDGDLSDFSLNDTEEDEEDLRDYIVL
                     NGNQADGCRSLSNSPRSGSGCGNPFASSRTSPCRNGQLSGSATNGNGNGASAGTGGGG
                     GVRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGIL
                     EWQQRQDGHGHEQNNNDNHMANGHAPAPDTAGEVLSAFRHIKCERLDGHQRNGTGNDL
                     LMIAPEALIKTELQQQASTYPEPPPAHPTASMAVAVAEARVLAALKPTTNTSSGGRSS
                     KRRIKLGLGLPTDLSVVKRRRT"
     misc_feature    487..666
                     /gene="LOC111072469"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     Drosophila melanogaster helix loop helix protein 3B
                     (dHLH3B) and similar proteins; Region:
                     bHLH_TS_dHLH3B_like; cd19708"
                     /db_xref="CDD:381551"
     misc_feature    order(490..492,502..504,508..516,520..522,535..537,
                     589..591,595..600)
                     /gene="LOC111072469"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381551"
     misc_feature    order(529..534,541..546,553..555,562..564,601..603,
                     610..615,622..624,628..636,640..645,652..654,661..666)
                     /gene="LOC111072469"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381551"
ORIGIN      
        1 atggcctggc taccgagcag ctcgaacgga tcggacaacg cggatgaacg gagtacggcg
       61 tccagcgcca gcgccagctc ggccgccggc agcagcggag ccaacggctc gcccaggcca
      121 gcagcaggag cagcaccagc taccgcttcg gctggggcac gccagccccc ggccctgctg
      181 cggcatgcca cgccctacct gcagcccaag acggaatcca tttcggacgg agatggtgac
      241 ctgtcggact tctcgctgaa cgacaccgag gaggatgagg aggatctgcg cgactacatc
      301 gtgctcaacg gcaatcaggc ggacggctgt cgctccctgt ccaactcccc gcgcagcggc
      361 agtggctgtg gcaatccctt cgctagctcc cgcacctcgc cctgtcgcaa cggacagctg
      421 tcgggcagcg caacaaatgg caacggtaat ggagcctccg cagggactgg cggtggcggt
      481 ggcgtccgta aggtgttcac caacacccgc gagcgctggc gccagcaaaa cgtgtccggg
      541 gcctttgcgg agctgcgcaa gctggtgccg actcatccgc cggacaagaa actgtccaag
      601 aacgagatcc tgcgttcggc catcaagtac atcaagctgc tgaccggcat cctcgagtgg
      661 cagcagcggc aggacgggca cggccacgag cagaacaata acgacaacca catggccaat
      721 ggccatgcac cagcgccgga caccgctggt gaagttctgt ccgctttccg gcacatcaag
      781 tgcgagcgcc tggacggaca tcagcgcaac ggaactggca acgatctact catgattgcc
      841 cccgaagcac tcatcaaaac tgagctgcag cagcaggcca gcacctaccc cgaaccccca
      901 ccggcgcatc caaccgcatc catggctgtg gcggtggccg aggcccgggt tcttgccgca
      961 ctgaagccga ccacaaatac ctcgtccggc ggcaggagca gcaaacggcg gattaagctg
     1021 ggcctgggcc tgcccaccga cctgagtgtg gtcaagcgac gcaggacctg agagccaagg
     1081 caggggacag ggcacagcct aagaggctga gacgcccaag ccaatcgttt cggagaagat
     1141 tggaagcaac catcagatac ataatctaat cgtatacaca aatacataac aatccttttt
     1201 ttttttgtta aataaattcg agtgcgacta t