Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura helix-loop-helix protein 1


LOCUS       XM_022364369             880 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072467), mRNA.
ACCESSION   XM_022364369
VERSION     XM_022364369.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364369.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..880
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..880
                     /gene="LOC111072467"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072467"
     CDS             138..644
                     /gene="LOC111072467"
                     /codon_start=1
                     /product="helix-loop-helix protein 1"
                     /protein_id="XP_022220061.1"
                     /db_xref="GeneID:111072467"
                     /translation="MVYDMTHMAEGPPQSISLSRYYMPEDDEMLAPANNGGLLHEDYA
                     ASTTLDIEKRFQARMSCETAAQPAPQPPPTPAPRRRTTPIAHLDPTELVGLSREERRR
                     RRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAY
                     LNHVLETP"
     misc_feature    453..635
                     /gene="LOC111072467"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     helix-loop-helix protein 1 (HEN-1) and similar proteins;
                     Region: bHLH_TS_HEN1; cd19701"
                     /db_xref="CDD:381544"
     misc_feature    order(468..470,480..482,486..494,498..500,513..515,
                     567..578)
                     /gene="LOC111072467"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381544"
     misc_feature    order(507..512,519..524,528..533,579..581,588..590,
                     600..602,606..611,621..623,627..632)
                     /gene="LOC111072467"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381544"
ORIGIN      
        1 gcgagcaggc aaacttttaa gctcatctcc ggatttcact tggaccgtgg acaaaccaaa
       61 gaattgtgcg gatattcgaa ttttttgctg tttgaatatt caactggcag caggagccgc
      121 cgccacacac tcccaagatg gtctacgaca tgacgcatat ggcagaggga ccgccgcaga
      181 gcatctccct gagtcgctac tatatgccgg aggatgacga gatgttggcg cccgccaaca
      241 atgggggcct gctgcacgag gactatgcgg ccagcaccac gctggacatt gagaagcgct
      301 tccaggcgcg tatgtcctgt gagacggccg cccagccggc accacagccg ccaccaacac
      361 cggcgccacg tcgccggacc acaccgattg cccacctgga tcccaccgag ctggtgggcc
      421 tgtcacgcga ggagcgacgt cgccggcgac gggccacact caagtatcga acggcgcatg
      481 ccacacggga gcgcatacgt gtggaggcgt tcaatgtgtc ctttgccgag ctgaggaagc
      541 tgctgcccac gctgccgcca gacaagaagc tctccaagat cgagatcctc aagctggcca
      601 tctgctacat tgcgtacttg aatcacgtgc tggagacccc ctgagatagt ggtagcgcct
      661 ctagcttcaa caccagctgc agcttcagtg aggccatgtt ctttgctccg ccataggatt
      721 gcgaatggaa cccccctgcc ccctctcccc catgaaccca tatcctgtat cctgtatcca
      781 tcaactataa agtacataca tatgtaaata cgtgtatgta tgtacgagta tctttattct
      841 agaaataatc gcaaaacacc tttttttgtc tagcttctaa