Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364369 880 bp mRNA linear INV 14-MAY-2021 (LOC111072467), mRNA. ACCESSION XM_022364369 VERSION XM_022364369.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364369.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..880 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..880 /gene="LOC111072467" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:111072467" CDS 138..644 /gene="LOC111072467" /codon_start=1 /product="helix-loop-helix protein 1" /protein_id="XP_022220061.1" /db_xref="GeneID:111072467" /translation="MVYDMTHMAEGPPQSISLSRYYMPEDDEMLAPANNGGLLHEDYA ASTTLDIEKRFQARMSCETAAQPAPQPPPTPAPRRRTTPIAHLDPTELVGLSREERRR RRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAY LNHVLETP" misc_feature 453..635 /gene="LOC111072467" /note="basic helix-loop-helix (bHLH) domain found in helix-loop-helix protein 1 (HEN-1) and similar proteins; Region: bHLH_TS_HEN1; cd19701" /db_xref="CDD:381544" misc_feature order(468..470,480..482,486..494,498..500,513..515, 567..578) /gene="LOC111072467" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:381544" misc_feature order(507..512,519..524,528..533,579..581,588..590, 600..602,606..611,621..623,627..632) /gene="LOC111072467" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381544" ORIGIN 1 gcgagcaggc aaacttttaa gctcatctcc ggatttcact tggaccgtgg acaaaccaaa 61 gaattgtgcg gatattcgaa ttttttgctg tttgaatatt caactggcag caggagccgc 121 cgccacacac tcccaagatg gtctacgaca tgacgcatat ggcagaggga ccgccgcaga 181 gcatctccct gagtcgctac tatatgccgg aggatgacga gatgttggcg cccgccaaca 241 atgggggcct gctgcacgag gactatgcgg ccagcaccac gctggacatt gagaagcgct 301 tccaggcgcg tatgtcctgt gagacggccg cccagccggc accacagccg ccaccaacac 361 cggcgccacg tcgccggacc acaccgattg cccacctgga tcccaccgag ctggtgggcc 421 tgtcacgcga ggagcgacgt cgccggcgac gggccacact caagtatcga acggcgcatg 481 ccacacggga gcgcatacgt gtggaggcgt tcaatgtgtc ctttgccgag ctgaggaagc 541 tgctgcccac gctgccgcca gacaagaagc tctccaagat cgagatcctc aagctggcca 601 tctgctacat tgcgtacttg aatcacgtgc tggagacccc ctgagatagt ggtagcgcct 661 ctagcttcaa caccagctgc agcttcagtg aggccatgtt ctttgctccg ccataggatt 721 gcgaatggaa cccccctgcc ccctctcccc catgaaccca tatcctgtat cctgtatcca 781 tcaactataa agtacataca tatgtaaata cgtgtatgta tgtacgagta tctttattct 841 agaaataatc gcaaaacacc tttttttgtc tagcttctaa