Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura cdc42 homolog (LOC111072466), mRNA.


LOCUS       XM_022364367            1273 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022364367
VERSION     XM_022364367.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364367.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1273
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1273
                     /gene="LOC111072466"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 35 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072466"
     CDS             123..698
                     /gene="LOC111072466"
                     /codon_start=1
                     /product="cdc42 homolog"
                     /protein_id="XP_022220059.1"
                     /db_xref="GeneID:111072466"
                     /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV
                     MIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEIT
                     HHCQKTPFLLVGTQIDLRDETSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSAL
                     TQKGLKNVFDEAILAALEPPEPTKKRKCKFL"
     misc_feature    129..653
                     /gene="LOC111072466"
                     /note="cell division cycle 42 (Cdc42) is a small GTPase of
                     the Rho family; Region: Cdc42; cd01874"
                     /db_xref="CDD:206664"
     misc_feature    order(129..131,135..137,213..218,225..230,234..239,
                     243..245,249..251,276..278,288..305,312..323,330..335,
                     339..344,429..434)
                     /gene="LOC111072466"
                     /note="GEF (guanine nucleotide exchange factor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(132..134,141..161,168..170,180..185,189..191,
                     204..206,210..266,276..281,291..311,321..326,330..332,
                     468..470,480..482,618..620,630..632,639..644,651..653)
                     /gene="LOC111072466"
                     /note="ACK tyrosine kinase interaction site [active]"
                     /db_xref="CDD:206664"
     misc_feature    150..173
                     /gene="LOC111072466"
                     /note="G1 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(159..176,207..209,216..221,225..227,291..296,
                     300..302,468..470,474..476,597..602)
                     /gene="LOC111072466"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206664"
     misc_feature    order(180..185,228..230,234..236,240..242,258..260,
                     321..323,330..332,639..644,651..653)
                     /gene="LOC111072466"
                     /note="CRIB effector interaction site [active]"
                     /db_xref="CDD:206664"
     misc_feature    order(189..197,231..233,237..245,249..251,255..263,
                     312..314,618..620)
                     /gene="LOC111072466"
                     /note="Par6 cell polarity protein interaction site
                     [active]"
                     /db_xref="CDD:206664"
     misc_feature    195..242
                     /gene="LOC111072466"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(216..218,222..224,228..233,303..314,321..323,
                     330..332)
                     /gene="LOC111072466"
                     /note="GAP (GTPase-activating protein) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    order(225..230,297..299,312..314,318..323,327..332,
                     339..341,429..434,438..440)
                     /gene="LOC111072466"
                     /note="GDI (guanine nucleotide dissociation inhibitor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206664"
     misc_feature    225..227
                     /gene="LOC111072466"
                     /note="G2 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    291..302
                     /gene="LOC111072466"
                     /note="G3 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    297..353
                     /gene="LOC111072466"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206664"
     misc_feature    465..476
                     /gene="LOC111072466"
                     /note="G4 box; other site"
                     /db_xref="CDD:206664"
     misc_feature    594..602
                     /gene="LOC111072466"
                     /note="G5 box; other site"
                     /db_xref="CDD:206664"
ORIGIN      
        1 tcgatggttt gacacctctg ttccgtaaaa aaaattgagc ccaacccact ccaaaaaaga
       61 aaaagaaata gaacggacgt ctagtacgta ccagaattac aataaattga gttttccaca
      121 aaatgcaaac catcaagtgt gtggtcgttg gcgacggagc tgtgggtaag acctgcctgc
      181 tcatctccta cacaaccaac aaatttccat cggaatatgt gccaactgta tttgacaatt
      241 atgcggtgac ggtgatgatt ggcggcgagc cctacacact gggcctgttc gatacggccg
      301 gtcaggagga ttacgatagg cttcgccctt tgtcctatcc gcagacagat gtctttctcg
      361 tatgcttctc ggtggtcagt cccagttcat ttgagaatgt taaagaaaag tgggttcctg
      421 agatcacgca ccattgccag aagacgccat tcctgctggt gggcacacag atcgatttgc
      481 gcgacgagac cagcacactt gagaagttgg ccaagaacaa gcaaaagccc atcaccatgg
      541 aacagggcga gaagctggcc aaagagctga aggccgtcaa atatgtcgag tgttcggctc
      601 tcacacaaaa gggtctgaaa aatgtcttcg atgaggccat actggccgcc ctggagccac
      661 cagaacccac caagaaaagg aagtgcaaat tcttataatt cttttttttt tttctctctt
      721 tctctcatgt cctatatatg tgtctgtttt tttcggcgtt tccacactac aatgtccctg
      781 cttctgcctt tatagacaag tctcttaccc ccaagataag ttttaaagtt ttaattgtag
      841 aattctacac tagttgcagt cctcctcccc ccagtcccag tctctagtac ttcagatggt
      901 tcctctgtga gccatccgtc cgcatttcct atcattttat tgggtaaagc tgctgtttaa
      961 tttgaatcca gtctgaatag tatctttttt acactatgga taaaggcttc cgccccagcc
     1021 cagacccaac cccaaaatcc aaagccttgg caaatggaat caaatataaa tcaaacaaaa
     1081 ttcttcgccc gaccccaaag ccagtcgggt cggtcccact actccatttt tgcacccact
     1141 gtagtttttt ttttttggcg aaatttctct aattaagtga aaaaagtaaa gatgatgaaa
     1201 cacaataaca atatagcgaa acaaattatt tatatataac tttatatata caacaaaaaa
     1261 agtcgtaagt gaa