PREDICTED: Drosophila obscura cdc42 homolog (LOC111072466), mRNA.
LOCUS XM_022364367 1273 bp mRNA linear INV 14-MAY-2021
ACCESSION XM_022364367
VERSION XM_022364367.2
DBLINK BioProject: PRJNA728747
KEYWORDS RefSeq.
SOURCE Drosophila obscura
ORGANISM Drosophila obscura
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_024542752.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
On May 14, 2021 this sequence version replaced XM_022364367.1.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila obscura Annotation
Release 101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.6
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1273
/organism="Drosophila obscura"
/mol_type="mRNA"
/isolate="BZ-5 IFL"
/db_xref="taxon:7282"
/chromosome="Unknown"
/sex="male"
/tissue_type="whole fly"
/dev_stage="Adult fly"
/geo_loc_name="Serbia: Babin Zub"
/collection_date="2017"
gene 1..1273
/gene="LOC111072466"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 35 Proteins, and 100% coverage of
the annotated genomic feature by RNAseq alignments,
including 17 samples with support for all annotated
introns"
/db_xref="GeneID:111072466"
CDS 123..698
/gene="LOC111072466"
/codon_start=1
/product="cdc42 homolog"
/protein_id="XP_022220059.1"
/db_xref="GeneID:111072466"
/translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV
MIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEIT
HHCQKTPFLLVGTQIDLRDETSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSAL
TQKGLKNVFDEAILAALEPPEPTKKRKCKFL"
misc_feature 129..653
/gene="LOC111072466"
/note="cell division cycle 42 (Cdc42) is a small GTPase of
the Rho family; Region: Cdc42; cd01874"
/db_xref="CDD:206664"
misc_feature order(129..131,135..137,213..218,225..230,234..239,
243..245,249..251,276..278,288..305,312..323,330..335,
339..344,429..434)
/gene="LOC111072466"
/note="GEF (guanine nucleotide exchange factor)
interaction site [polypeptide binding]; other site"
/db_xref="CDD:206664"
misc_feature order(132..134,141..161,168..170,180..185,189..191,
204..206,210..266,276..281,291..311,321..326,330..332,
468..470,480..482,618..620,630..632,639..644,651..653)
/gene="LOC111072466"
/note="ACK tyrosine kinase interaction site [active]"
/db_xref="CDD:206664"
misc_feature 150..173
/gene="LOC111072466"
/note="G1 box; other site"
/db_xref="CDD:206664"
misc_feature order(159..176,207..209,216..221,225..227,291..296,
300..302,468..470,474..476,597..602)
/gene="LOC111072466"
/note="GTP/Mg2+ binding site [chemical binding]; other
site"
/db_xref="CDD:206664"
misc_feature order(180..185,228..230,234..236,240..242,258..260,
321..323,330..332,639..644,651..653)
/gene="LOC111072466"
/note="CRIB effector interaction site [active]"
/db_xref="CDD:206664"
misc_feature order(189..197,231..233,237..245,249..251,255..263,
312..314,618..620)
/gene="LOC111072466"
/note="Par6 cell polarity protein interaction site
[active]"
/db_xref="CDD:206664"
misc_feature 195..242
/gene="LOC111072466"
/note="Switch I region; other site"
/db_xref="CDD:206664"
misc_feature order(216..218,222..224,228..233,303..314,321..323,
330..332)
/gene="LOC111072466"
/note="GAP (GTPase-activating protein) interaction site
[polypeptide binding]; other site"
/db_xref="CDD:206664"
misc_feature order(225..230,297..299,312..314,318..323,327..332,
339..341,429..434,438..440)
/gene="LOC111072466"
/note="GDI (guanine nucleotide dissociation inhibitor)
interaction site [polypeptide binding]; other site"
/db_xref="CDD:206664"
misc_feature 225..227
/gene="LOC111072466"
/note="G2 box; other site"
/db_xref="CDD:206664"
misc_feature 291..302
/gene="LOC111072466"
/note="G3 box; other site"
/db_xref="CDD:206664"
misc_feature 297..353
/gene="LOC111072466"
/note="Switch II region; other site"
/db_xref="CDD:206664"
misc_feature 465..476
/gene="LOC111072466"
/note="G4 box; other site"
/db_xref="CDD:206664"
misc_feature 594..602
/gene="LOC111072466"
/note="G5 box; other site"
/db_xref="CDD:206664"
ORIGIN
1 tcgatggttt gacacctctg ttccgtaaaa aaaattgagc ccaacccact ccaaaaaaga
61 aaaagaaata gaacggacgt ctagtacgta ccagaattac aataaattga gttttccaca
121 aaatgcaaac catcaagtgt gtggtcgttg gcgacggagc tgtgggtaag acctgcctgc
181 tcatctccta cacaaccaac aaatttccat cggaatatgt gccaactgta tttgacaatt
241 atgcggtgac ggtgatgatt ggcggcgagc cctacacact gggcctgttc gatacggccg
301 gtcaggagga ttacgatagg cttcgccctt tgtcctatcc gcagacagat gtctttctcg
361 tatgcttctc ggtggtcagt cccagttcat ttgagaatgt taaagaaaag tgggttcctg
421 agatcacgca ccattgccag aagacgccat tcctgctggt gggcacacag atcgatttgc
481 gcgacgagac cagcacactt gagaagttgg ccaagaacaa gcaaaagccc atcaccatgg
541 aacagggcga gaagctggcc aaagagctga aggccgtcaa atatgtcgag tgttcggctc
601 tcacacaaaa gggtctgaaa aatgtcttcg atgaggccat actggccgcc ctggagccac
661 cagaacccac caagaaaagg aagtgcaaat tcttataatt cttttttttt tttctctctt
721 tctctcatgt cctatatatg tgtctgtttt tttcggcgtt tccacactac aatgtccctg
781 cttctgcctt tatagacaag tctcttaccc ccaagataag ttttaaagtt ttaattgtag
841 aattctacac tagttgcagt cctcctcccc ccagtcccag tctctagtac ttcagatggt
901 tcctctgtga gccatccgtc cgcatttcct atcattttat tgggtaaagc tgctgtttaa
961 tttgaatcca gtctgaatag tatctttttt acactatgga taaaggcttc cgccccagcc
1021 cagacccaac cccaaaatcc aaagccttgg caaatggaat caaatataaa tcaaacaaaa
1081 ttcttcgccc gaccccaaag ccagtcgggt cggtcccact actccatttt tgcacccact
1141 gtagtttttt ttttttggcg aaatttctct aattaagtga aaaaagtaaa gatgatgaaa
1201 cacaataaca atatagcgaa acaaattatt tatatataac tttatatata caacaaaaaa
1261 agtcgtaagt gaa