PREDICTED: Drosophila obscura 39S ribosomal protein L30,

LOCUS       XM_022364366             679 bp    mRNA    linear   INV 14-MAY-2021
            mitochondrial (LOC111072465), mRNA.
ACCESSION   XM_022364366
VERSION     XM_022364366.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364366.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..679
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..679
                     /gene="LOC111072465"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072465"
     CDS             76..618
                     /gene="LOC111072465"
                     /codon_start=1
                     /product="39S ribosomal protein L30, mitochondrial"
                     /protein_id="XP_022220058.2"
                     /db_xref="GeneID:111072465"
                     /translation="MNLGRLLTPLQVSTALARSYGKHNKKYLYKDGKKYEGIIYYPRT
                     PDHQDPPIEPAKLFRVQRIKPVKGNPFWEKRILKDLGLDGKQSDYTVVKNIPENNARL
                     WKIKHLIKVTPVTFPYGEPTAQDVKHTILKENGECLVTKDIGPVEVRTEARDAFDRQP
                     KRLDTDLLRKDSRLKWLNPW"
     misc_feature    250..408
                     /gene="LOC111072465"
                     /note="Ribosomal protein L30, which is found in eukaryotes
                     and prokaryotes but not in archaea, is one of the smallest
                     ribosomal proteins with a molecular mass of about 7kDa.
                     L30 binds the 23SrRNA as well as the 5S rRNA and is one of
                     five ribosomal proteins that...; Region:
                     Ribosomal_L30_like; cd00355"
                     /db_xref="CDD:100098"
     misc_feature    order(262..270,286..294,298..303,307..318,325..339,
                     361..378,382..387,391..399)
                     /gene="LOC111072465"
                     /note="23S rRNA binding site - archaea [nucleotide
                     binding]; other site"
                     /db_xref="CDD:100098"
     misc_feature    order(265..270,286..291,298..303,310..318,325..327,
                     334..336,349..354,361..369,373..378)
                     /gene="LOC111072465"
                     /note="23S rRNA binding site - prokaryotes [nucleotide
                     binding]; other site"
                     /db_xref="CDD:100098"
     misc_feature    order(382..387,391..399)
                     /gene="LOC111072465"
                     /note="5S rRNA binding site - archaea; other site"
                     /db_xref="CDD:100098"
ORIGIN      
        1 tagatattta catccccatg tcataacact tgcggctccc ccatagtatt tttaattgca
       61 aaactattag ataaaatgaa cctgggccga ctactgacac ctctccaggt gagcactgca
      121 ctggcccgca gctatggaaa gcacaacaag aagtatctgt acaaggatgg caagaaatac
      181 gagggcataa tttactaccc cagaacaccc gaccatcagg atccgcctat agagcccgcc
      241 aaactgtttc gagtgcagcg catcaagccg gtgaagggga atcccttctg ggagaagcgc
      301 attctgaaag atctgggctt ggatggcaaa cagagcgact acacggtggt caagaacata
      361 cccgagaaca atgcccgctt gtggaagatc aagcatttaa ttaaggtcac accggtcacg
      421 tttccatatg gcgagcccac ggcacaggat gtcaagcaca cgatactcaa ggagaatggc
      481 gagtgcctgg tcaccaagga tattggcccc gtggaagtgc gcacggaggc acgcgatgca
      541 ttcgaccggc aaccgaagcg cctggacacg gacctgctca gaaaggattc tcgtctgaag
      601 tggctcaatc cttggtaaag aaaaatatgc ctgtggctgc tttattcctt taacaacaat
      661 aaaataatat caaatgcaa