PREDICTED: Drosophila obscura torsin-like protein (LOC111072463),

LOCUS       XM_022364364            1170 bp    mRNA    linear   INV 14-MAY-2021
            mRNA.
ACCESSION   XM_022364364
VERSION     XM_022364364.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364364.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1170
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1170
                     /gene="LOC111072463"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072463"
     CDS             67..1080
                     /gene="LOC111072463"
                     /codon_start=1
                     /product="torsin-like protein"
                     /protein_id="XP_022220056.2"
                     /db_xref="GeneID:111072463"
                     /translation="MNVTNCLLLCLGGLLFCTHFCQSIEPLTIGAAIGISTVGLTYFK
                     SQTYCRFYECCDDRSIPANITALRLSLEKTLYGQHIVAQHIIPALTAHFSAQSKSRKP
                     LVLSFHGQPGTGKNFVADQIAKALYLEGSNSGYVVKYLGRSDFPQAEFVGIYKERISN
                     EVRSHLRSCPRSLFIFDEVDKMPSGVLDTLTSLVDYNAFTDGTDHTKAIFIFLSNTAG
                     THIADHLGNSMKAGKLREDTRLSDYEPLLQRAAYNMDGGMKKTSLIEAHVIDHYIPFL
                     PLEKAHVVQCLEAEFRRWDKTPDRDIINDILSSSISYDRMHGLFVSSGCKTLEKKVAM
                     AIY"
     misc_feature    232..594
                     /gene="LOC111072463"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    391..414
                     /gene="LOC111072463"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(394..417,595..597,709..711)
                     /gene="LOC111072463"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    583..600
                     /gene="LOC111072463"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
ORIGIN      
        1 ggcgaacaag ttttgtttga cctgctggaa ttggtcggga cgggacggga gttattcttt
       61 cttgaaatga atgtaaccaa ctgcctgcta ttgtgccttg gaggcttgct attttgcaca
      121 cacttttgtc agagcattga gcccttgaca attggggctg ccatagggat tagcaccgtc
      181 ggcttaacat atttcaagag ccagacctat tgccggtttt atgaatgctg cgacgacaga
      241 agcattcctg ccaatataac cgcgctgcgg ttgtcgctgg aaaaaacact atacggccag
      301 catattgtgg cccagcacat cataccagca ctgacagcgc actttagcgc ccagagcaag
      361 tcgcgaaagc cgctggtgct tagttttcat ggccagccgg gcaccggaaa gaactttgtg
      421 gccgatcaga ttgccaaagc tctctacttg gagggatcga atagcggtta tgttgtgaag
      481 tacctgggac gatcggactt cccacaagcc gagtttgttg gcatttacaa ggaacgcatt
      541 agcaatgagg tacgctctca tttgaggagt tgtccacgct ccctgttcat attcgatgag
      601 gtggataaga tgcccagtgg cgtgttggac acgctcacct cgctggtgga ctacaatgcc
      661 ttcaccgatg gcaccgacca cacaaaggcc atattcattt ttctgtcaaa cactgccggc
      721 acccatatcg ccgaccattt gggtaatagc atgaaggcgg gaaaactgcg cgaggataca
      781 cgcctgagcg actatgagcc gctgctgcag agagctgcct acaacatgga cggcggcatg
      841 aagaaaacta gtctgattga ggcacacgtc atcgatcact acataccatt cctgccgcta
      901 gagaaggcgc atgttgtgca gtgcctggag gcggagttcc ggcggtggga caagacgccc
      961 gatagggata tcatcaacga catcctatcc tcatcgatca gctatgatcg catgcatggc
     1021 ctgtttgtca gctccggctg caagaccctc gagaagaagg tggccatggc catttactag
     1081 ctttacaaac gaaaacgtac ttgcacttgc atttgatatt attttattgt tgttaaagga
     1141 ataaagcagc cacaggcata tttttcttta