PREDICTED: Drosophila obscura uncharacterized LOC111072460

LOCUS       XM_022364347             592 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072460), mRNA.
ACCESSION   XM_022364347
VERSION     XM_022364347.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364347.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..592
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..592
                     /gene="LOC111072460"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111072460"
     CDS             58..519
                     /gene="LOC111072460"
                     /codon_start=1
                     /product="uncharacterized protein LOC111072460"
                     /protein_id="XP_022220039.2"
                     /db_xref="GeneID:111072460"
                     /translation="MSPLEQITTKHLSSLFFGGSLEPQCGSNSDEEEPTLHQESSGLM
                     SFCLLYLGMGMLFFCISAITDKHTQHQSRLKKERRQRGRSLRYRSIAPRRRRPTVSGR
                     KHQRKGTEEYGTTDRDVWQDPSGQEEKDEDQQQGDFYFDTLSYAEGADPHP"
ORIGIN      
        1 cttccaaatc accgaaccga accgcccctc ccaacctccc tactgcatac tggcaaaatg
       61 tcgccgctcg aacagataac aacgaaacat ttgagcagct tgttctttgg cggatccttg
      121 gagccacaat gcggcagcaa cagcgacgag gaggagccca ccctgcacca ggagtcatcc
      181 ggcctaatga gcttctgcct tctgtacctg ggaatgggga tgctcttctt ctgcatcagc
      241 gccatcaccg acaagcacac gcagcaccag tcacgactga agaaggagcg ccgtcagaga
      301 gggcgttcgt tgcgctatcg ctccattgct ccacgcaggc ggcgtcccac tgtcagcggg
      361 cgcaagcacc agaggaaggg cacagaggag tacggaacga cggatcgaga tgtttggcag
      421 gacccctctg ggcaggagga gaaggatgag gatcagcagc agggcgactt ctactttgac
      481 accctgtcgt acgctgaagg cgctgatccg cacccatagc catccaaatt ccaaattcaa
      541 aaccaataag cggcacaata aatttacaat aaaattaaag tcaaaagcaa aa