Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura 3-hydroxyacyl-CoA dehydrogenase


LOCUS       XM_022364343             993 bp    mRNA    linear   INV 14-MAY-2021
            type-2 (LOC111072456), mRNA.
ACCESSION   XM_022364343
VERSION     XM_022364343.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364343.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..993
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..993
                     /gene="LOC111072456"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 25 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072456"
     CDS             57..824
                     /gene="LOC111072456"
                     /codon_start=1
                     /product="3-hydroxyacyl-CoA dehydrogenase type-2"
                     /protein_id="XP_022220035.1"
                     /db_xref="GeneID:111072456"
                     /translation="MIKNAVSLVTGGASGLGRATAERLARQGASVVLADLPSSKGNEV
                     AKELGDKVVFVPVDVTSEKDVSAALQIAKDKFGRLDLTVNCAGTATAVKTFNFNKNVA
                     HRLEDFQRVININTVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQA
                     AYAASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFP
                     QRLGEPSEYAHLVQAIFENPLLNGEVIRIDGALRMMP"
     misc_feature    63..821
                     /gene="LOC111072456"
                     /note="17hydroxysteroid dehydrogenase type 10
                     (HSD10)-like, classical (c) SDRs; Region:
                     HSD10-like_SDR_c; cd05371"
                     /db_xref="CDD:187629"
     misc_feature    order(87..89,96..104,159..164,225..233,309..317,396..398,
                     495..503,540..542,552..554,630..641,645..656)
                     /gene="LOC111072456"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187629"
     misc_feature    order(333..341,345..347,360..365,369..371,378..383,
                     390..392,402..407,414..419,426..428,435..440,447..449,
                     468..476,510..530,534..536,543..548,555..560,567..572,
                     576..584,588..593,597..608,612..614,639..641,702..710,
                     714..722,732..734,741..746,753..755,759..806,810..821)
                     /gene="LOC111072456"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    order(333..341,360..365,369..371,378..380,390..392,
                     405..407,414..419,426..428,510..530,534..536,543..548,
                     555..560,567..572,579..584,588..593,813..821)
                     /gene="LOC111072456"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    order(399..401,501..503,540..542,552..554)
                     /gene="LOC111072456"
                     /note="active site"
                     /db_xref="CDD:187629"
ORIGIN      
        1 tctgtcgcct tgtcgctggt tttgtgcaac gttataaact aataaacaat atcaaaatga
       61 tcaagaacgc cgtctctttg gtgaccggtg gagcctccgg tctgggtcgc gctacagccg
      121 agcgtctggc caggcagggt gccagcgtgg tgctcgccga tttgccttcc tcgaagggca
      181 acgaagtggc caaggagctg ggcgacaagg tggtctttgt gcccgtcgat gtcacctcgg
      241 agaaggatgt gagtgctgcc ctgcagatcg ccaaggataa gttcggccgc ctggatctca
      301 ccgtcaactg tgccggcact gcgacggccg tgaagacctt caactttaac aagaatgtgg
      361 cccacaggct ggaggatttc cagcgcgtga tcaacatcaa cacggtgggc accttcaatg
      421 tgattcgcct gtccgctgga ctgatgggcg ccaacgagcc taatcaggac gggcaacgcg
      481 gcgtcatcgt gaacactgcc tctgtggctg cctttgacgg ccagatcgga caggctgcct
      541 acgcggcctc caaggcggct gtggtgggca tgaccctgcc cattgcccgt gacctcagca
      601 cccagggcat tcgcatctgc accattgccc caggtctgtt caacacaccc atgctggcgg
      661 ccctgcccga gaaggtgcgc accttcctgg ccaagagcat ccccttcccc cagcgtctgg
      721 gcgagccgag cgagtatgcc catctggtgc aggccatctt tgagaatccc ctgctcaacg
      781 gcgaagtcat ccgcatcgat ggtgccctgc gcatgatgcc ctaggatcac tgacagtagg
      841 acacgacaca catatcaatg agctcgatca gattgcattt atcccaatat gcccagaacg
      901 tggccttgta acgctaacgc cgccctgttt tactctattt ctattaatta agtcaagagt
      961 tgttgtattc ttctgccccg aaattatgta ata