Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364329 2788 bp mRNA linear INV 14-MAY-2021 receptor 1 (LOC111072451), mRNA. ACCESSION XM_022364329 VERSION XM_022364329.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364329.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-438 JAECWW010000165.1 1632097-1632534 c 439-539 JAECWW010000165.1 1630133-1630233 c 540-590 JAECWW010000165.1 1630081-1630131 c 591-989 JAECWW010000165.1 1629611-1630009 c 990-1965 JAECWW010000165.1 1628510-1629485 c 1966-2135 JAECWW010000165.1 1628269-1628438 c 2136-2269 JAECWW010000165.1 1628057-1628190 c 2270-2788 JAECWW010000165.1 1627471-1627989 c FEATURES Location/Qualifiers source 1..2788 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..2788 /gene="LOC111072451" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="GeneID:111072451" CDS 522..2546 /gene="LOC111072451" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: xenotropic and polytropic retrovirus receptor 1" /protein_id="XP_022220021.1" /db_xref="GeneID:111072451" /translation="MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVED DVLKRHFANFDENFFHYCDKELKKINTFYSEKLAEATRKFANLNAELKSCIEESERSA KKSKGQKRLAALPDRKARELKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRV DTGAKWRQEYVEASHFFTNKDIDNIINETETTVTGELEGGDRQRAMKRLRVPPLGEQQ SPWTTFKVGLFSGSFIVLGIVVVLSAIFHEISGENLKVTFRLYRGPLLIIEFIFLIGV NIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVVWTLSMLSFLYSASLSIPAF INPLTLTLIMVLFLANPFHVLHHDARFWLWRITGRCISAPFFHVGFADFWLGDQLNSL ATAILDFEYLICFYFTNGNWSEANDASICMEKDYIIRPIVNCLPAWFRFAQCLRRYRD SREAFPHLVNAGKYSTTFLVVIFATLKSFHSQNYASTFDNPYTWLWIIASIVSSCYAY TWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAIVEDLALRFIWVLSFYLTEMKI VSGDIMTSITGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILR MMDESDGVINRYTKTNRPKPKKIKDPEKRSLLQPRGSMPDLRIDIDSKKL" misc_feature 525..989 /gene="LOC111072451" /note="SPX domain of the xenotropic and polytropic retrovirus receptor 1 (XPR1) and related proteins; Region: SPX_XPR1_like; cd14477" /db_xref="CDD:269898" misc_feature 1293..2312 /gene="LOC111072451" /note="EXS family; Region: EXS; pfam03124" /db_xref="CDD:460816" ORIGIN 1 tgcacttctc cctccgccga aatagttagt tataattgcc acccaaaaga aatacatgca 61 gcagatagat agtacaaagt ttctggattc tttgtttttg ttattccgtc gtacggtctg 121 gtcgtctgct ccgtgcgtgg gtgttcggtt cggttgtgcg cgcttccctg tgataagcag 181 tgtacttaat aaatcagcga ctgttgacaa ttagtaatga ttgtgagtgg atcaggtgct 241 tgctgagaga aaaaacttca tttaacaatc catctatata gctttaacaa tgtgctgctg 301 caacgaattc tgtacaaaag tcggatagct cctcctctac gattggccat tggcactctt 361 tgcagcgctg cccactgcac tgtaactgca agctgcagca tcaggcagca gcgcaacagc 421 agcagcagca gcgtatatca cttgcagacg cacttccagt gagggagagg agagacaatc 481 cttggaatca aagctagagg caaagccgag ccgccttaac catgaagttt gccgagcatc 541 tgtcggcgca cataacgccc gagtggcgca agcagtacat caactatgag gaaatgaagg 601 ccatgctgta cttggccgtc gaggaggccc cttcggtgga gagtgtcgag gatgatgtgc 661 tgaagcgtca ctttgccaac ttcgatgaga atttctttca ctactgcgac aaggaactga 721 agaagatcaa tacgttctat tcggaaaagc tggcggaggc cacgcgcaag tttgccaatc 781 tgaatgcgga gctaaagagc tgcatcgagg agtccgagcg gagtgcaaaa aagtcaaagg 841 gacagaagcg tctggccgcc ctgcccgatc gcaaggcgcg cgaactgaag ttggccttca 901 gcgagttcta cctgagtctc attctcctgc agaactatca gaatctgaat cacactgggt 961 tccgtaagat actcaaaaag catgacaagc ttttgcgcgt tgacaccggc gccaagtggc 1021 gacaggagta cgtggaggcg tcgcatttct ttaccaacaa agacatcgac aacattataa 1081 atgagacgga gacgacggta accggcgaac tggagggcgg cgatcgccag cgggcaatga 1141 aacggctgcg cgtaccaccg ctgggggagc agcagagtcc gtggaccacc tttaaggtgg 1201 gcctcttctc cggcagcttc attgtgctgg gcattgtggt ggtgctgtcg gccatcttcc 1261 atgagatcag cggggagaac ctgaaggtca cattccgcct ctatcgcggc cccctgctga 1321 tcatcgagtt tatcttcctg attggcgtga atatctacgg ctggcgttcg tccggcgtta 1381 atcatgtgct catttttgaa ctggatccgc gcaatcatct ctccgagcag catctcatgg 1441 aactggccgc catcttcggt gtggtatgga cgctcagcat gctgagcttc ctgtacagcg 1501 ccagcctgtc cattccggcg ttcattaacc ccctgacgct cacgctaatc atggtgctct 1561 tcctggccaa tccgtttcat gtgctgcatc acgatgcccg cttctggctg tggcggatca 1621 ccggacggtg catatcggcg ccattctttc acgtgggctt cgccgatttc tggctgggcg 1681 atcagctcaa ctctctggcc accgccatac tggactttga gtatctcatc tgcttctact 1741 ttaccaacgg caactggtcg gaggcgaatg atgcctccat ttgcatggag aaggactaca 1801 tcatccggcc gattgtcaac tgtctgccgg cgtggttccg attcgcccaa tgcctgcgac 1861 ggtaccggga ctcgcgtgag gcctttcccc atctggtaaa tgccggcaaa tactcgacca 1921 cgttcctcgt cgtgatcttt gccaccctca agtcgttcca cagtcagaac tatgccagca 1981 cgtttgacaa tccgtatacg tggctctgga taatcgcctc gatagtgtcc tcctgctatg 2041 cgtacacgtg ggatatcaag atggattggg gcctgttcga taagaatgcc ggcgagaata 2101 catttctgcg ggaagaggtg gtctactcat cgacgggctt ctactatttt gcaattgttg 2161 aggatctggc actgcgcttc atttgggtgc tttccttcta tctgacggag atgaagattg 2221 ttagcggtga catcatgacc tccattacgg gcatccttga ggtcttccgt cgctttgtgt 2281 ggaacttctt tcgattggag aacgagcatc tgaacaattg cggcaagttc cgagcggtgc 2341 gtgacatttc gattgcgccg ctcgactcct ccgatcaagc gctcatccta cgcatgatgg 2401 acgagtcgga tggtgtgatc aatcgctaca caaagacgaa ccgacccaag ccgaaaaaga 2461 tcaaggatcc ggagaagcgc agcctgttgc agccgcgcgg ctcaatgccc gatcttcgga 2521 tagatatcga tagcaaaaag ttataggcag acctacgcca acggctcgac caaattgtgc 2581 tgcccatgga acgattattg agaatgtggt gcaacgattc ggccctaacg ataattctaa 2641 tactattatc gacctttttt ttgttcatct tttttttgtg cccattgttt agctaatttg 2701 tactatatct atatcatatt taacttacta gttacgttaa gtgtacttaa acgcaaagga 2761 aacggaaacg gaaaggcaaa cgaaactg