Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura xenotropic and polytropic retrovirus


LOCUS       XM_022364329            2788 bp    mRNA    linear   INV 14-MAY-2021
            receptor 1 (LOC111072451), mRNA.
ACCESSION   XM_022364329
VERSION     XM_022364329.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364329.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-438               JAECWW010000165.1  1632097-1632534     c
            439-539             JAECWW010000165.1  1630133-1630233     c
            540-590             JAECWW010000165.1  1630081-1630131     c
            591-989             JAECWW010000165.1  1629611-1630009     c
            990-1965            JAECWW010000165.1  1628510-1629485     c
            1966-2135           JAECWW010000165.1  1628269-1628438     c
            2136-2269           JAECWW010000165.1  1628057-1628190     c
            2270-2788           JAECWW010000165.1  1627471-1627989     c
FEATURES             Location/Qualifiers
     source          1..2788
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..2788
                     /gene="LOC111072451"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 5 Proteins, and 97% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     16 samples with support for all annotated introns"
                     /db_xref="GeneID:111072451"
     CDS             522..2546
                     /gene="LOC111072451"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: xenotropic and polytropic
                     retrovirus receptor 1"
                     /protein_id="XP_022220021.1"
                     /db_xref="GeneID:111072451"
                     /translation="MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVED
                     DVLKRHFANFDENFFHYCDKELKKINTFYSEKLAEATRKFANLNAELKSCIEESERSA
                     KKSKGQKRLAALPDRKARELKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRV
                     DTGAKWRQEYVEASHFFTNKDIDNIINETETTVTGELEGGDRQRAMKRLRVPPLGEQQ
                     SPWTTFKVGLFSGSFIVLGIVVVLSAIFHEISGENLKVTFRLYRGPLLIIEFIFLIGV
                     NIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVVWTLSMLSFLYSASLSIPAF
                     INPLTLTLIMVLFLANPFHVLHHDARFWLWRITGRCISAPFFHVGFADFWLGDQLNSL
                     ATAILDFEYLICFYFTNGNWSEANDASICMEKDYIIRPIVNCLPAWFRFAQCLRRYRD
                     SREAFPHLVNAGKYSTTFLVVIFATLKSFHSQNYASTFDNPYTWLWIIASIVSSCYAY
                     TWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAIVEDLALRFIWVLSFYLTEMKI
                     VSGDIMTSITGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILR
                     MMDESDGVINRYTKTNRPKPKKIKDPEKRSLLQPRGSMPDLRIDIDSKKL"
     misc_feature    525..989
                     /gene="LOC111072451"
                     /note="SPX domain of the xenotropic and polytropic
                     retrovirus receptor 1 (XPR1) and related proteins; Region:
                     SPX_XPR1_like; cd14477"
                     /db_xref="CDD:269898"
     misc_feature    1293..2312
                     /gene="LOC111072451"
                     /note="EXS family; Region: EXS; pfam03124"
                     /db_xref="CDD:460816"
ORIGIN      
        1 tgcacttctc cctccgccga aatagttagt tataattgcc acccaaaaga aatacatgca
       61 gcagatagat agtacaaagt ttctggattc tttgtttttg ttattccgtc gtacggtctg
      121 gtcgtctgct ccgtgcgtgg gtgttcggtt cggttgtgcg cgcttccctg tgataagcag
      181 tgtacttaat aaatcagcga ctgttgacaa ttagtaatga ttgtgagtgg atcaggtgct
      241 tgctgagaga aaaaacttca tttaacaatc catctatata gctttaacaa tgtgctgctg
      301 caacgaattc tgtacaaaag tcggatagct cctcctctac gattggccat tggcactctt
      361 tgcagcgctg cccactgcac tgtaactgca agctgcagca tcaggcagca gcgcaacagc
      421 agcagcagca gcgtatatca cttgcagacg cacttccagt gagggagagg agagacaatc
      481 cttggaatca aagctagagg caaagccgag ccgccttaac catgaagttt gccgagcatc
      541 tgtcggcgca cataacgccc gagtggcgca agcagtacat caactatgag gaaatgaagg
      601 ccatgctgta cttggccgtc gaggaggccc cttcggtgga gagtgtcgag gatgatgtgc
      661 tgaagcgtca ctttgccaac ttcgatgaga atttctttca ctactgcgac aaggaactga
      721 agaagatcaa tacgttctat tcggaaaagc tggcggaggc cacgcgcaag tttgccaatc
      781 tgaatgcgga gctaaagagc tgcatcgagg agtccgagcg gagtgcaaaa aagtcaaagg
      841 gacagaagcg tctggccgcc ctgcccgatc gcaaggcgcg cgaactgaag ttggccttca
      901 gcgagttcta cctgagtctc attctcctgc agaactatca gaatctgaat cacactgggt
      961 tccgtaagat actcaaaaag catgacaagc ttttgcgcgt tgacaccggc gccaagtggc
     1021 gacaggagta cgtggaggcg tcgcatttct ttaccaacaa agacatcgac aacattataa
     1081 atgagacgga gacgacggta accggcgaac tggagggcgg cgatcgccag cgggcaatga
     1141 aacggctgcg cgtaccaccg ctgggggagc agcagagtcc gtggaccacc tttaaggtgg
     1201 gcctcttctc cggcagcttc attgtgctgg gcattgtggt ggtgctgtcg gccatcttcc
     1261 atgagatcag cggggagaac ctgaaggtca cattccgcct ctatcgcggc cccctgctga
     1321 tcatcgagtt tatcttcctg attggcgtga atatctacgg ctggcgttcg tccggcgtta
     1381 atcatgtgct catttttgaa ctggatccgc gcaatcatct ctccgagcag catctcatgg
     1441 aactggccgc catcttcggt gtggtatgga cgctcagcat gctgagcttc ctgtacagcg
     1501 ccagcctgtc cattccggcg ttcattaacc ccctgacgct cacgctaatc atggtgctct
     1561 tcctggccaa tccgtttcat gtgctgcatc acgatgcccg cttctggctg tggcggatca
     1621 ccggacggtg catatcggcg ccattctttc acgtgggctt cgccgatttc tggctgggcg
     1681 atcagctcaa ctctctggcc accgccatac tggactttga gtatctcatc tgcttctact
     1741 ttaccaacgg caactggtcg gaggcgaatg atgcctccat ttgcatggag aaggactaca
     1801 tcatccggcc gattgtcaac tgtctgccgg cgtggttccg attcgcccaa tgcctgcgac
     1861 ggtaccggga ctcgcgtgag gcctttcccc atctggtaaa tgccggcaaa tactcgacca
     1921 cgttcctcgt cgtgatcttt gccaccctca agtcgttcca cagtcagaac tatgccagca
     1981 cgtttgacaa tccgtatacg tggctctgga taatcgcctc gatagtgtcc tcctgctatg
     2041 cgtacacgtg ggatatcaag atggattggg gcctgttcga taagaatgcc ggcgagaata
     2101 catttctgcg ggaagaggtg gtctactcat cgacgggctt ctactatttt gcaattgttg
     2161 aggatctggc actgcgcttc atttgggtgc tttccttcta tctgacggag atgaagattg
     2221 ttagcggtga catcatgacc tccattacgg gcatccttga ggtcttccgt cgctttgtgt
     2281 ggaacttctt tcgattggag aacgagcatc tgaacaattg cggcaagttc cgagcggtgc
     2341 gtgacatttc gattgcgccg ctcgactcct ccgatcaagc gctcatccta cgcatgatgg
     2401 acgagtcgga tggtgtgatc aatcgctaca caaagacgaa ccgacccaag ccgaaaaaga
     2461 tcaaggatcc ggagaagcgc agcctgttgc agccgcgcgg ctcaatgccc gatcttcgga
     2521 tagatatcga tagcaaaaag ttataggcag acctacgcca acggctcgac caaattgtgc
     2581 tgcccatgga acgattattg agaatgtggt gcaacgattc ggccctaacg ataattctaa
     2641 tactattatc gacctttttt ttgttcatct tttttttgtg cccattgttt agctaatttg
     2701 tactatatct atatcatatt taacttacta gttacgttaa gtgtacttaa acgcaaagga
     2761 aacggaaacg gaaaggcaaa cgaaactg