Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura epidermal retinol dehydrogenase 2


LOCUS       XM_022364325            1425 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072446), mRNA.
ACCESSION   XM_022364325
VERSION     XM_022364325.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364325.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1425
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1425
                     /gene="LOC111072446"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072446"
     CDS             181..1155
                     /gene="LOC111072446"
                     /codon_start=1
                     /product="epidermal retinol dehydrogenase 2"
                     /protein_id="XP_022220017.2"
                     /db_xref="GeneID:111072446"
                     /translation="MSKVSQSAGNASGNGTTTNSSDIYNIVLLVVDIVMLLVKFWLSI
                     IESIIGLFQTKPLENVNGKFVLITGAGHGMGKQMALQYAALGATVICWDVNEQTNNQT
                     VKDIKQKGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPILEHTE
                     NEIRLMYDINVISHFWMIQSFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAV
                     RGYMAALSEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIAPDVAAASI
                     IQAQREGLEEAAVPRSYLTLEKIGRLVPRKAMRLVNDFIDTGVDTDKY"
     misc_feature    373..1092
                     /gene="LOC111072446"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(385..387,391..396,400..402,457..465,616..624,
                     766..774,811..813,823..825,913..924)
                     /gene="LOC111072446"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(688..690,772..774,811..813,823..825)
                     /gene="LOC111072446"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
        1 gcacacggtg ctgtgcgtag tgtttacttt tgtcgaaact cagtccgaat tcgttaacag
       61 ccgctaacgg tttgctcttg ctctgctcca cgatctaaca ccaccaccac cacccatcac
      121 ccaccgatcc ttgaacacag cacacacaca cacacacaca caactgaaat cctcgccaac
      181 atgtccaaag tgtcgcaaag cgctggcaat gctagcggta acggtaccac aaccaacagc
      241 agcgacatct acaacattgt gctgctagtg gtggacattg tgatgctgtt ggtcaaattc
      301 tggctgtcga taatcgaatc gataatcggc ctcttccaga cgaagccgct ggagaatgtg
      361 aacggtaaat ttgtgctgat caccggcgca gggcatggca tgggcaagca aatggcattg
      421 cagtacgcgg ccttgggggc caccgtcatc tgctgggacg tgaacgagca gaccaacaat
      481 cagacggtga aggatatcaa gcagaagggc ggcaaggcct ttggctatgt gtgcaatgtg
      541 acaaagcgcg aggagctgat tgagttggcc cagaaggtgc gcaaggagca tggcttcatc
      601 catgtggtgg ttaacaatgc cggcattatg ccctgccatc caattttgga gcacaccgag
      661 aacgagattc gtctcatgta cgacatcaat gtgatctcac atttctggat gattcaatcc
      721 ttcctgcccg acatgatcga gcgcaacgaa ggcagcattg tggcgctttc ctcctgtgcc
      781 ggactctttg gtctcatcaa tctggtgccc tactgcggca ccaagttcgc cgtacgcggc
      841 tacatggccg ccctcagcga ggagctgcgc caaaagaatc cacagaataa cgtaaaactg
      901 accaccatct atccgtacat gatcgacacg ggtctgtgca agaatccccg ctaccgtttc
      961 cccaacctgt tcaagttgat tgcgcccgat gtggcggccg cttccattat tcaggcacag
     1021 cgcgagggtc tcgaggaggc agccgtgcca cgcagctatc tgacgctgga gaagatcgga
     1081 cgtcttgtgc cccgcaaggc aatgcgactg gtcaacgatt tcattgacac gggcgtcgac
     1141 acggacaagt actagaacag gacgagaagc agcgagcagc agcagcagca gcaccacctc
     1201 ctactaccac tactactcct ctgccgtaca ctctgcatta ggtcctagag ctttattaat
     1261 tttttttttt aatttttgtc tataattaat ttcccctaac tgctttgtgt gcgtatatta
     1321 attgtagcct catttctttg gagaaatgtg aattcagaaa ggttgttact taaatgctta
     1381 aatgctaatt gtgtggggtc gtaataaaag tcgccataaa aatga