Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364325 1425 bp mRNA linear INV 14-MAY-2021 (LOC111072446), mRNA. ACCESSION XM_022364325 VERSION XM_022364325.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364325.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1425 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1425 /gene="LOC111072446" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111072446" CDS 181..1155 /gene="LOC111072446" /codon_start=1 /product="epidermal retinol dehydrogenase 2" /protein_id="XP_022220017.2" /db_xref="GeneID:111072446" /translation="MSKVSQSAGNASGNGTTTNSSDIYNIVLLVVDIVMLLVKFWLSI IESIIGLFQTKPLENVNGKFVLITGAGHGMGKQMALQYAALGATVICWDVNEQTNNQT VKDIKQKGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMPCHPILEHTE NEIRLMYDINVISHFWMIQSFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAV RGYMAALSEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYRFPNLFKLIAPDVAAASI IQAQREGLEEAAVPRSYLTLEKIGRLVPRKAMRLVNDFIDTGVDTDKY" misc_feature 373..1092 /gene="LOC111072446" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(385..387,391..396,400..402,457..465,616..624, 766..774,811..813,823..825,913..924) /gene="LOC111072446" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(688..690,772..774,811..813,823..825) /gene="LOC111072446" /note="active site" /db_xref="CDD:187535" ORIGIN 1 gcacacggtg ctgtgcgtag tgtttacttt tgtcgaaact cagtccgaat tcgttaacag 61 ccgctaacgg tttgctcttg ctctgctcca cgatctaaca ccaccaccac cacccatcac 121 ccaccgatcc ttgaacacag cacacacaca cacacacaca caactgaaat cctcgccaac 181 atgtccaaag tgtcgcaaag cgctggcaat gctagcggta acggtaccac aaccaacagc 241 agcgacatct acaacattgt gctgctagtg gtggacattg tgatgctgtt ggtcaaattc 301 tggctgtcga taatcgaatc gataatcggc ctcttccaga cgaagccgct ggagaatgtg 361 aacggtaaat ttgtgctgat caccggcgca gggcatggca tgggcaagca aatggcattg 421 cagtacgcgg ccttgggggc caccgtcatc tgctgggacg tgaacgagca gaccaacaat 481 cagacggtga aggatatcaa gcagaagggc ggcaaggcct ttggctatgt gtgcaatgtg 541 acaaagcgcg aggagctgat tgagttggcc cagaaggtgc gcaaggagca tggcttcatc 601 catgtggtgg ttaacaatgc cggcattatg ccctgccatc caattttgga gcacaccgag 661 aacgagattc gtctcatgta cgacatcaat gtgatctcac atttctggat gattcaatcc 721 ttcctgcccg acatgatcga gcgcaacgaa ggcagcattg tggcgctttc ctcctgtgcc 781 ggactctttg gtctcatcaa tctggtgccc tactgcggca ccaagttcgc cgtacgcggc 841 tacatggccg ccctcagcga ggagctgcgc caaaagaatc cacagaataa cgtaaaactg 901 accaccatct atccgtacat gatcgacacg ggtctgtgca agaatccccg ctaccgtttc 961 cccaacctgt tcaagttgat tgcgcccgat gtggcggccg cttccattat tcaggcacag 1021 cgcgagggtc tcgaggaggc agccgtgcca cgcagctatc tgacgctgga gaagatcgga 1081 cgtcttgtgc cccgcaaggc aatgcgactg gtcaacgatt tcattgacac gggcgtcgac 1141 acggacaagt actagaacag gacgagaagc agcgagcagc agcagcagca gcaccacctc 1201 ctactaccac tactactcct ctgccgtaca ctctgcatta ggtcctagag ctttattaat 1261 tttttttttt aatttttgtc tataattaat ttcccctaac tgctttgtgt gcgtatatta 1321 attgtagcct catttctttg gagaaatgtg aattcagaaa ggttgttact taaatgctta 1381 aatgctaatt gtgtggggtc gtaataaaag tcgccataaa aatga