Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura protein Flattop homolog


LOCUS       XM_022364321             787 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072444), transcript variant X1, mRNA.
ACCESSION   XM_022364321
VERSION     XM_022364321.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364321.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..787
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..787
                     /gene="LOC111072444"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072444"
     CDS             125..760
                     /gene="LOC111072444"
                     /codon_start=1
                     /product="protein Flattop homolog isoform X1"
                     /protein_id="XP_022220013.2"
                     /db_xref="GeneID:111072444"
                     /translation="MAFHFSANQFEDRFQAPGLCNWEYPRFAPPRPRRYLKKATPIVD
                     NSGHLLPTARRDGNSFGRYRGTYELPLKITRSFCGHYDACLSGRYKFRDFPRDLCNCQ
                     RENRRALACDKRVTLGVSGDPYWARPKCQSKCEGIQQIKELHQLSVRCKRAICPIKSP
                     RTVCVPAKSRITCVKVDRSRKRTITAFAANREPSKATKEEAKTKAPKQPKK"
     misc_feature    128..343
                     /gene="LOC111072444"
                     /note="protein Flattop and similar proteins; Region:
                     Flattop; cd23705"
                     /db_xref="CDD:467918"
     misc_feature    order(128..160,164..166,173..199,215..220,227..253,
                     260..262,266..271,281..289,302..331,335..343)
                     /gene="LOC111072444"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467918"
ORIGIN      
        1 cctcgattcc aaattcaaat attcaaaaat cacaaaatta aaaaatcaac aaaaactcaa
       61 aaatccgaaa cctaaaaaat caaaaactca aaaattccaa aatcttttgc tgtgtttgtg
      121 gacaatggct tttcatttta gtgctaatca gtttgaggac cgctttcagg cgccaggact
      181 ctgcaattgg gagtatccac gctttgcacc gccacggccc aggcgatacc tgaagaaagc
      241 cacgcccatt gtggacaata gtggtcacct gctgcccacc gcccgaaggg acggcaactc
      301 ctttggacga tatcgtggca cctacgagct accgctgaag ataacgcgca gcttttgcgg
      361 ccactatgac gcctgcttga gcggacgcta caagttccgc gactttccac gggatctgtg
      421 caactgccag cgggagaacc gtcgcgcctt ggcctgcgac aagcgggtga cactgggcgt
      481 tagcggggat ccgtattggg cgcgtcccaa gtgccagtcc aagtgcgagg gcatccagca
      541 gatcaaggag ctccatcagc tgagtgttcg ctgcaagcgt gccatttgtc ccatcaagag
      601 ccccagaacg gtttgcgtgc cagccaagtc gcggataacc tgcgtcaagg tggatagatc
      661 acgcaagcga accatcacgg ccttcgctgc gaatcgtgag cccagcaagg cgaccaaaga
      721 agaagcaaag accaaagccc ccaagcagcc aaagaaatag aagcagttaa agatgaagca
      781 gatacag